Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
CLCA1 antibody
The CLCA1 antibody is a neutralizing monoclonal antibody that is widely used in Life Sciences research. It specifically targets CLCA1, a protein involved in various biological processes including the regulation of epidermal growth factor and hepatocyte growth factor. This antibody has been shown to inhibit the activity of CLCA1 by binding to its target site, preventing its interaction with other proteins or growth factors. In addition, the CLCA1 antibody can be used for immobilization studies or as a tool for detecting CLCA1 dimers in experimental settings. Its high specificity and affinity make it an essential tool for researchers studying the role of CLCA1 in different cellular processes.
GLIS3 antibody
GLIS3 antibody was raised in rabbit using the N terminal of GLIS3 as the immunogenDegré de pureté :Min. 95%HIV1 antibody (HTLV3)
HIV1 antibody (HTLV3) was raised in goat using human isolate as the immunogen.Degré de pureté :Min. 95%PIWIL1 antibody
PIWIL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FQELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTNHFR
TXNRD1 antibody
The TXNRD1 antibody is a highly specialized product used in Life Sciences research. It is available as both polyclonal and monoclonal antibodies, providing researchers with a versatile tool for their experiments.
ACTN2 antibody
ACTN2 antibody was raised in rabbit using the C terminal of ACTN2 as the immunogenDegré de pureté :Min. 95%LETMD1 antibody
LETMD1 antibody was raised using the middle region of LETMD1 corresponding to a region with amino acids LLRHRLKTHTTVIHQLDKALAKLGIGQLTAQEVKSACYLRGLNSTHIGED
Degré de pureté :Min. 95%MAP2 antibody
The MAP2 antibody is a growth factor antagonist that binds to specific proteins in order to inhibit their activity. It is a monoclonal antibody, meaning it is produced from a single clone of cells and is highly specific in its binding properties. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.
Degré de pureté :Min. 95%HIV1 p24 antibody (FITC)
HIV1 p24 antibody (FITC) was raised in goat using purified native p24 from strain IIIB as the immunogen.GALC antibody
GALC antibody was raised using the middle region of GALC corresponding to a region with amino acids LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALDegré de pureté :Min. 95%RHBDL2 antibody
RHBDL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KWMLPEKSRGTYLERANCFPPPVFIISISLAELAVFIYYAVWKPQKQWIT
Degré de pureté :Min. 95%PAI1 antibody
PAI1 antibody was raised in sheep using Recombinant Plasminogen Activator Inhibitor-1 prepared from bacterial extracts as the immunogen.Degré de pureté :Min. 95%
