Anticorps primaires

The TOPK antibody is a monoclonal antibody that targets the T-LAK cell-originated protein kinase (TOPK). This antibody is widely used in Life Sciences research to study the role of TOPK in various cellular processes. It has been shown to interact with chemokines, interferons, and epidermal growth factors, suggesting its involvement in immune responses and cell signaling pathways. The TOPK antibody is highly specific and can be used for applications such as immunofluorescence, Western blotting, and immunoprecipitation. Its binding to TOPK effectively inhibits its kinase activity, making it a valuable tool for studying the function of this family kinase. The TOPK antibody is available as both a monoclonal and polyclonal antibody, providing researchers with options to suit their experimental needs. Its high affinity for TOPK ensures reliable and accurate results in experiments. With its neutralizing properties, this antibody can help elucidate the molecular mechanisms underlying various diseases and aid in the

Rabbit polyclonal RPS6KC1 antibody

The Keratin 19 antibody is a highly specialized monoclonal antibody that targets the growth factor Keratin 19. It is commonly used in Life Sciences research for various applications such as hybridization studies, high-affinity glucose binding assays, and polymerase chain reactions (PCR). This antibody can also be utilized in the development of polymeric micelles for drug delivery systems and as a tool in gene therapy using adeno-associated virus vectors. Additionally, the Keratin 19 antibody has been shown to play a role in preventing deprivation-induced apoptosis by targeting molecular pathways involved in cell survival. Its specificity towards Keratin 19 makes it an ideal tool for studying sugar transport mechanisms, collagen synthesis, and the effects of compounds like okadaic acid on cellular processes. With its exceptional affinity and versatility, the Keratin 19 antibody is an invaluable asset for researchers exploring a wide range of molecular targets in their scientific investigations.

Affinity purified Rabbit polyclonal alpha SNAP antibody

Rabbit polyclonal RAD23B antibody

GBA3 antibody was raised in Rabbit using Human GBA3 as the immunogen

TFPI antibody was raised in sheep using Synthetic peptide corresponding to NH-terminus of human TFPI conjugated to carrier as the immunogen.

ECD antibody was raised in Rabbit using Human ECD as the immunogen

CD40 antibody is a monoclonal antibody used in Life Sciences for various applications. It specifically targets CD40, a cell surface receptor involved in immune responses. This antibody can activate human endothelial cells and has been shown to have antiangiogenic properties, reducing microvessel density. CD40 antibody can be used in combination with other therapies for antiangiogenic therapy. Additionally, it has been used in DNA vaccine studies to enhance the immune response by targeting antigenic peptides. CD40 antibody has also been found to inhibit the production of tumor necrosis factor-alpha (TNF-α), which plays a role in inflammation and immune response regulation.

Rabbit Polyclonal MYPT1 antibody (Thr853)

The IL4 antibody is a highly specialized product used in the field of Life Sciences. It is an essential tool for researchers studying various aspects of immunology and molecular biology. This antibody specifically targets interleukin-4 (IL-4), a cytokine involved in immune responses and inflammation.

hCG antibody was raised in mouse using the beta subunit of hCG as the immunogen.

DENND1A antibody was raised using the N terminal of DENND1A corresponding to a region with amino acids PGVSVHLSVHSYFTVPDTRELPSIPENRNLTEYFVAVDVNNMLHLYASML

Rabbit polyclonal VEGFC antibody (HRP)

Affinity purified Rabbit polyclonal Beta ETF antibody

CACNG6 antibody was raised using the N terminal of CACNG6 corresponding to a region with amino acids RAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTEFWVELNTYKAN

Rabbit polyclonal HMGB1 antibody (FITC)