Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
Tyrosine Hydroxylase antibody
The Tyrosine Hydroxylase antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets and detects tyrosine hydroxylase, an enzyme involved in the synthesis of dopamine, a neurotransmitter that plays a crucial role in various physiological processes. The Tyrosine Hydroxylase antibody recognizes an epitope located within the protein sequence of tyrosine hydroxylase, allowing for precise and accurate detection.
SLC25A22 antibody
SLC25A22 antibody was raised using a synthetic peptide corresponding to a region with amino acids LQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRS
PCAF antibody
The PCAF antibody is a monoclonal antibody that specifically targets the amino-terminal region of the PCAF protein. This antibody has been extensively studied and has shown promising results in various applications. It has been found to have neutralizing activity against TNF-α, a key cytokine involved in inflammatory processes. Additionally, the PCAF antibody has been shown to inhibit the formation of dimers of chemokine receptors, which are important for cell migration and activation.
RGS4 antibody
The RGS4 antibody is a polyclonal antibody that targets the growth factor receptor. It specifically binds to the activated form of epidermal growth factor (EGF) and inhibits its signaling pathway. This antibody has been widely used in life sciences research to study the role of EGF in various cellular processes, including cell proliferation, migration, and differentiation. Additionally, the RGS4 antibody has shown cytotoxic effects on cancer cells expressing high levels of c-myc and HER2/neu receptors. It can be used in combination with other antibodies such as trastuzumab to enhance their efficacy. The high viscosity of this antibody solution allows for easy handling and ensures consistent results. Overall, the RGS4 antibody is a valuable tool for researchers studying growth factor signaling pathways and their role in disease progression.
CYP1A2 antibody
The CYP1A2 antibody is a highly specific antibody that is used in various research and diagnostic applications. It is a polyclonal antibody that has been developed to target the CYP1A2 protein, which is an enzyme involved in drug metabolism in the liver. This antibody has been extensively tested and validated for its specificity and sensitivity.
IL10 antibody
The IL10 antibody is a powerful tool in the field of Life Sciences. It specifically targets and neutralizes Interleukin-10 (IL-10), a cytokine that plays a crucial role in immune regulation and inflammation. By binding to IL-10, this antibody inhibits its cytotoxic effects and prevents it from interacting with its receptors.
CRELD1 antibody
CRELD1 antibody was raised using the C terminal of CRELD1 corresponding to a region with amino acids TEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPESAGFFSEMTE
