Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
PDX1 antibody
The PDX1 antibody is a monoclonal antibody that is commonly used in the field of Life Sciences. It specifically targets alpha-fetoprotein, androgen, lysozyme, and other glycoproteins. This antibody is widely utilized in research laboratories for various applications such as protein analysis, glycan profiling, and glycosylation studies. It has also been used to detect autoantibodies in human serum samples. The PDX1 antibody offers high specificity and sensitivity, making it an essential tool for scientists working in the field of Life Sciences. Whether you are conducting experiments or performing diagnostic assays, this antibody will provide reliable results.GAPDH antibody
The GAPDH antibody is a highly effective monoclonal antibody that has been activated to target specific proteins in the body. It is commonly used in Life Sciences research to study various cellular processes and pathways. This antibody has been found to neutralize the activity of TGF-beta, a protein involved in cell growth and differentiation. Additionally, it has shown to have glycosylation properties, which can impact protein function and stability. One of the key targets of the GAPDH antibody is E-cadherin, a protein responsible for cell adhesion and tissue integrity. By binding to E-cadherin, this antibody can modulate cell-cell interactions and potentially influence cellular behavior. Furthermore, studies have demonstrated that the GAPDH antibody can inhibit collagen production, which is crucial for maintaining tissue structure and elasticity. This property may have implications in wound healing and tissue regeneration. Another important aspect of the GAPDH antibody is its ability to regulate microvessel density. By targeting specific proteins involved in angiogenesis, thisPPM1G antibody
The PPM1G antibody is a highly effective medicament that has been extensively studied in various scientific fields, including hybridization and human hepatocytes. This antibody specifically targets pancreatic elastase, an enzyme involved in the breakdown of proteins in the pancreas. By inhibiting the activity of pancreatic elastase, this antibody can prevent cytotoxic effects and promote overall health.
Goat anti Rabbit IgG (Fab'2) (HRP)
Goat anti-rabbit IgG (Fab'2) (HRP) was raised in goat using rabbit IgG F(c) fragment as the immunogen.Degré de pureté :Min. 95%RP11-529I10.4 antibody
RP11-529I10.4 antibody was raised using the middle region of RP11-529I10.4 corresponding to a region with amino acids APLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVD
Cdc25C antibody
Cdc25C antibody was raised in Mouse using a purified recombinant fragment of human Cdc25C expressed in E. coli as the immunogen.
CD79b antibody (PE)
CD79b antibody (PE) was raised in hamster using the beta chain of the murine B-cell receptor as the immunogen.
Degré de pureté :Min. 95%Connexin 26 antibody
The Connexin 26 antibody is a highly effective biomolecule used in Life Sciences research. It is a polyclonal antibody that specifically targets and neutralizes the Connexin 26 protein, which plays a crucial role in cell communication. This antibody is widely used to study various cellular processes, including the regulation of glucagon secretion, autoantibody production, and the function of glycoproteins and steroids. Additionally, this monoclonal antibody has been proven to be effective in detecting and studying other biomolecules such as collagen, myelin-associated glycoprotein, interferon, and basic proteins. Researchers rely on the Connexin 26 antibody for its high specificity and reliability in their studies.
Angiotensin II antibody
The Angiotensin II antibody is a powerful tool in the field of immunology. It is an antibody specifically designed to target and bind to angiotensin II, a hormone involved in regulating blood pressure and fluid balance in the body. This antibody can be used for various applications, including research studies, diagnostic tests, and therapeutic interventions.
