Anticorps primaires

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections as it has strong bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

Rabbit polyclonal GABRB1 antibody

HYAL3 antibody was raised in rabbit using the C terminal of HYAL3 as the immunogen

The RAB3A antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in various cellular processes, including cytotoxicity, mitogen-activated protein signaling, and protein synthesis. This antibody specifically targets RAB3A, a small GTPase involved in vesicle trafficking and neurotransmitter release.

Affinity purified Rabbit polyclonal CDC26 antibody

The RXRB antibody is a monoclonal antibody that targets the retinoid X receptor beta (RXRB). This receptor is involved in various cellular processes, including growth and development. The RXRB antibody has been shown to have cytotoxic effects on cancer cells, particularly in HL-60 cells. It binds to specific binding proteins and inhibits the activity of tumor necrosis factor-alpha (TNF-α) and vascular endothelial growth factor (VEGF), which are important factors in cancer progression. Additionally, the RXRB antibody has been found to have anti-glycation properties and may play a role in regulating hormone peptides. In the field of Life Sciences, this antibody is widely used for research purposes, including studying signal transduction pathways and developing targeted therapies. It is also being investigated as a potential family kinase inhibitor and an anti-CD33 antibody for the treatment of certain types of leukemia.

Rabbit polyclonal GSK3 beta antibody (Ser9)

TRNT1 antibody was raised using the N terminal of TRNT1 corresponding to a region with amino acids PQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITT

COL4A3 antibody is a high-quality antibody used in Life Sciences research. It is specifically designed to target and bind to the COL4A3 protein, which plays a crucial role in various biological processes. This antibody has been extensively tested and validated for its specificity and sensitivity.

Rabbit polyclonal CSFR antibody (Tyr561)

C20ORF144 antibody was raised using the middle region of C20Orf144 corresponding to a region with amino acids EARRPEEGGARAALSWPRLLSRFRSPGKAPREAGPAEEQPRKRCRCPRPQ

GABARAPL2 antibody was raised in Rabbit using Human GABARAPL2 as the immunogen

CD62E antibody was raised in mouse using human CD62E/E-selectin as the immunogen.

The YBX1 antibody is a highly specialized diagnostic reagent used in the field of Life Sciences. It is an antibody that specifically targets the YBX1 protein, which plays a crucial role in various cellular functions including protein-protein interactions and regulation of gene expression. This antibody can be used in flow immunoassays to detect the presence of YBX1 in human serum or other biological samples.

ATG16L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAA

Mouse monoclonal HMOX2 antibody

Affinity purified Rabbit polyclonal GIPC3 antibody

GBP1 antibody was raised in Rabbit using Human GBP1 as the immunogen