Anticorps primaires

Affinity purified Rabbit polyclonal XPNPEP2 antibody

The NR1H3 antibody is a highly specialized monoclonal antibody that targets the chemokine receptor NR1H3. This receptor plays a crucial role in the immune response to viral infections by regulating the activity of serine proteases and other key molecules involved in antiviral defense. The NR1H3 antibody has been extensively studied and proven to be effective in neutralizing the activity of NR1H3, thereby inhibiting viral replication and spread.

The SERP1 antibody is a polyclonal antibody that targets nuclear and adipose tissues. It is widely used in life sciences research for its neutralizing properties against glycoproteins. This antibody has been shown to be effective in inhibiting connexin agents and promoting endothelial growth. It can also be used as a diagnostic tool for detecting alpha-fetoprotein levels in human serum. The SERP1 antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. With its high specificity and affinity, this antibody is an essential tool for studying various biological processes and diseases.

ART3 antibody was raised in Rabbit using Human ART3 as the immunogen

The HSF1 antibody is a medicament that consists of dimers with an amino-terminal domain. It has the ability to neutralize tumor necrosis factor-alpha (TNF-α) and natriuretic peptides. This glycoprotein antibody is widely used in Life Sciences research for its ability to detect and quantify specific proteins in various biological samples. The HSF1 antibody can be used in applications such as Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA). It is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific experimental needs. The HSF1 antibody's high specificity and sensitivity make it an essential tool for studying cellular processes and protein functions. With its advanced glycosylation techniques, this antibody ensures accurate results by minimizing non-specific binding and interference from other molecules.

TRPM5 antibody was raised using the N terminal of TRPM5 corresponding to a region with amino acids EKHISEQRAGYGGTGSIEIPVLCLLVNGDPNTLERISRAVEQAAPWLILV

ATP6V1B2 antibody was raised using the middle region of ATP6V1B2 corresponding to a region with amino acids NFIAQGPYENRTVFETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAK

BATF antibody was raised in Rabbit using Human BATF as the immunogen

CAPN7 antibody was raised in Rabbit using Human CAPN7 as the immunogen

This antibody reacts with heavy chains on human IgM (mu chain).

PGK1 antibody was raised using the C terminal of PGK1 corresponding to a region with amino acids ATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAR

Rabbit polyclonal FABP antibody (Cardiac) (HRP)

Rat monoclonal CCR7 antibody (allophycocyanin)

MEIS3 antibody was raised in Rabbit using Human MEIS3 as the immunogen

The DECR1 antibody is a highly specialized peptide agent used in Life Sciences research. It is designed to target and neutralize antiphospholipid antibodies, which are reactive molecules found in human serum. This antibody exhibits catalase activity, making it an effective tool for studying the function of catalase enzymes. Additionally, the DECR1 antibody has been shown to bind to basic proteins and globulins, further expanding its potential applications in various research fields. As a glycoprotein with anticoagulant properties, this antibody can be used to investigate the role of autoantibodies in coagulation disorders. Researchers rely on the specificity and reliability of the DECR1 antibody to advance their understanding of complex biological processes.

The STAT5A antibody is a highly effective medicament that targets the STAT5A protein, a key player in various cellular processes. This antibody specifically binds to STAT5A and inhibits its activity, leading to a decrease in TGF-beta signaling and reduced microvessel density. The use of this antibody has shown promising results in blocking IL-17A-induced inflammation and has been used as a research tool to study the role of STAT5A in oncogenic kinase signaling pathways. Additionally, this antibody can be used for immunohistochemistry and Western blotting to detect and quantify STAT5A protein levels in cells and tissues. With its high specificity and sensitivity, this monoclonal antibody is an indispensable tool for researchers studying growth factors, messenger RNA regulation, and protein inhibitors.

Sheep polyclonal Hydroxyindole antibody

Purified Rabbit polyclonal EPHA4 antibody (Tyr596)

The ORM2 antibody is a highly specialized monoclonal antibody that is used in various applications within the field of life sciences. This antibody specifically targets and reacts with the ORM2 protein, which is found in blood plasma and plays a crucial role in transporting fatty acids. The ORM2 antibody can be used in assays such as double-label immunofluorescence to detect the presence and localization of ORM2 protein in different cell types or tissues. It has also been utilized in studies involving pluripotent stem cells, where it helps identify specific markers such as neuronspecific enolase. With its high specificity and affinity, the ORM2 antibody provides researchers with a valuable tool for investigating the functions and interactions of this important protein.

MRPS27 antibody was raised in Rabbit using Human MRPS27 as the immunogen