Anticorps primaires

The IL4 antibody is a highly specialized product used in the field of Life Sciences. It is an essential tool for researchers studying various aspects of immunology and molecular biology. This antibody specifically targets interleukin-4 (IL-4), a cytokine involved in immune responses and inflammation.

CD40 antibody is a monoclonal antibody used in Life Sciences for various applications. It specifically targets CD40, a cell surface receptor involved in immune responses. This antibody can activate human endothelial cells and has been shown to have antiangiogenic properties, reducing microvessel density. CD40 antibody can be used in combination with other therapies for antiangiogenic therapy. Additionally, it has been used in DNA vaccine studies to enhance the immune response by targeting antigenic peptides. CD40 antibody has also been found to inhibit the production of tumor necrosis factor-alpha (TNF-α), which plays a role in inflammation and immune response regulation.

GBA3 antibody was raised in Rabbit using Human GBA3 as the immunogen

Affinity purified Rabbit polyclonal alpha SNAP antibody

The Keratin 19 antibody is a highly specialized monoclonal antibody that targets the growth factor Keratin 19. It is commonly used in Life Sciences research for various applications such as hybridization studies, high-affinity glucose binding assays, and polymerase chain reactions (PCR). This antibody can also be utilized in the development of polymeric micelles for drug delivery systems and as a tool in gene therapy using adeno-associated virus vectors. Additionally, the Keratin 19 antibody has been shown to play a role in preventing deprivation-induced apoptosis by targeting molecular pathways involved in cell survival. Its specificity towards Keratin 19 makes it an ideal tool for studying sugar transport mechanisms, collagen synthesis, and the effects of compounds like okadaic acid on cellular processes. With its exceptional affinity and versatility, the Keratin 19 antibody is an invaluable asset for researchers exploring a wide range of molecular targets in their scientific investigations.

EDN1 antibody was raised in Rabbit using Human EDN1 as the immunogen

Rad9 antibody is a monoclonal antibody that specifically binds to Rad9, a protein involved in DNA damage response and repair. This antibody has been shown to be highly effective in detecting Rad9 in various biological samples, including pleural fluid and human serum. It can be used for research purposes in the field of life sciences to study the role of Rad9 in cellular processes such as DNA repair, cell cycle regulation, and apoptosis. Additionally, Rad9 antibody has antiangiogenic properties and can inhibit endothelial growth by binding to specific receptors on endothelial cells. Its cytotoxic effects make it a promising candidate for targeted cancer therapy. With its high specificity and affinity for Rad9, this antibody is an invaluable tool for scientists studying biomolecules and their interactions.

Rabbit polyclonal TR19L antibody

D2HGDH antibody was raised in Rabbit using Human D2HGDH as the immunogen

Mouse anti-25OH Vitamin D2/D3 antibody

DLEU1 antibody was raised in Rabbit using Human DLEU1 as the immunogen

SLC25A29 antibody was raised using the C terminal of SLC25A29 corresponding to a region with amino acids AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPA

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is known to effectively treat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. Through its binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp technique studies on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.

The iNOS antibody is a neuroprotective monoclonal antibody that targets inducible nitric oxide synthase (iNOS). It is commonly used in Life Sciences research and has shown promising results in various studies. This antibody specifically binds to iNOS, inhibiting its activity and preventing the production of nitric oxide. Nitric oxide is a signaling molecule that plays a role in various physiological processes, including inflammation and neuronal signaling. By blocking iNOS, the antibody can help reduce inflammation and protect neurons from damage.

CDC73 antibody was raised in Rabbit using Human CDC73 as the immunogen

WFDC1 antibody was raised using the middle region of WFDC1 corresponding to a region with amino acids VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF

Fibrinogen antibody was raised in sheep using human Fibrinogen purified from plasma as the immunogen.

Rabbit polyclonal PTPN18 antibody

The SPTLC1 antibody is a highly specialized polyclonal antibody that plays a crucial role in various life science applications. It is designed to target and bind to the SPTLC1 protein, which is involved in the synthesis of sphingolipids, an essential component of cell membranes.