Anticorps primaires

Affinity purified Rabbit polyclonal CRHSP24 antibody

Rabbit polyclonal MAP2K1 antibody (Thr386)

Affinity purified Rabbit polyclonal CCDC83 antibody

The TOP2A antibody is a polyclonal antibody that targets the TOP2A protein. This protein is involved in various cellular processes, including DNA replication and repair. It plays a crucial role in regulating cell growth and division.

The RAD18 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the chemokine receptor RAD18, which is involved in the immune response. This antibody can be used for various applications, such as immunoassays and neutralizing experiments. The RAD18 antibody is a chimeric protein composed of human immunoglobulin and can effectively bind to RAD18 glycoprotein. It has been shown to activate interferon and steroid signaling pathways, making it a valuable tool for studying immune responses and related diseases. With its high specificity and potency, the RAD18 antibody is an essential component in any research involving chemokines and their interactions with the immune system.

Rabbit polyclonal MAP2K1 antibody (Thr292)

Mycoplasma pneumoniae antibody is a product used in Life Sciences research to study protein-protein interactions. It is a monoclonal antibody that specifically targets and binds to Mycoplasma pneumoniae, a bacterium known to cause respiratory infections. The antibody can be used in various applications such as immunohistochemical detection, fluorescence immunochromatography, and polymerase chain reactions. It is highly specific and sensitive, making it an ideal tool for detecting the presence of Mycoplasma pneumoniae in samples such as human serum or cell cultures. This antibody can also be used to study the role of Mycoplasma pneumoniae in autoimmune diseases by investigating the presence of autoantibodies. Its high affinity for Mycoplasma pneumoniae antigens ensures accurate and reliable results in research experiments.

CLDN18 antibody was raised in Rabbit using Human CLDN18 as the immunogen

Rabbit polyclonal CAMK2 A/B antibody (Thr286)

The PAD4 antibody is a highly specialized medicament used in the field of Life Sciences. It is an acidic, EGF-like glycoprotein that plays a crucial role in various biological processes. This antibody is particularly known for its ability to neutralize and inhibit the activity of glial fibrillary acidic protein (GFAP), which is found predominantly in adipocytes.

Affinity purified Rabbit polyclonal FMO3 antibody

RAD23A antibody was raised using a synthetic peptide corresponding to a region with amino acids  GIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ

The MAG antibody is a highly specialized antibody that has various characteristics and applications. It is a DNA aptamer that acts as an active agent, capable of neutralizing the effects of SN-38, a potent cytotoxic compound. The MAG antibody can be used in various research and diagnostic applications due to its specificity and binding affinity.

The CD2 antibody is a monoclonal antibody that targets the CD2 protein, which plays a crucial role in T-cell activation and growth factor signaling. This antibody specifically binds to the activated form of CD2 and has been shown to inhibit T-cell proliferation and cytokine production. Additionally, it has hypomethylating properties, which may contribute to its anti-inflammatory effects. The CD2 antibody is commonly used in Life Sciences research for studying T-cell biology and immune responses. It can also be used in combination with other antibodies or inhibitors for antibody-drug conjugate therapy. Furthermore, this antibody has been utilized in various studies involving extracellular histones, tyrosine kinase inhibitors like imatinib, and intracellular signaling pathways such as p38 MAPK. Its versatility and specificity make it an invaluable tool for researchers in the field of immunology.

CRP antibody was raised using the N terminal of CRP corresponding to a region with amino acids MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA

HCCS antibody was raised in rabbit using the C terminal of HCCS as the immunogen

GAMT antibody was raised in Rabbit using Human GAMT as the immunogen

BRAF antibody was raised in Mouse using a purified recombinant fragment of human BRAF expressed in E. coli as the immunogen.

Affinity purified Rabbit polyclonal XRCC2 antibody