Anticorps primaires

Rabbit Polyclonal GSK3 beta antibody (Tyr216)

The hCG beta antibody is a protein that belongs to the Life Sciences category. It functions by binding to the nuclear factor kappa-light-chain-enhancer in order to regulate gene expression. This antibody is commonly used in research and diagnostic applications, particularly in the field of reproductive health. It has been shown to interact with various proteins, including mitogen-activated protein and β-catenin, which are involved in cellular signaling pathways. Additionally, this antibody has been found to have an inhibitory effect on the activity of p38 mitogen-activated protein phosphatase and caspase-9, both of which play important roles in cell growth and apoptosis. The hCG beta antibody is available as a monoclonal antibody, making it highly specific and reliable for use in experiments and assays requiring precise detection and analysis of target molecules.

The CD49b antibody is a specific antibody that is commonly used in immunoassays. It is designed to bind to the CD49b protein, which is found on the surface of various cell types including granulosa cells and mesenchymal stem cells. This antibody forms a disulfide bond with the CD49b protein, allowing for easy detection and quantification in biological samples.

IFN gamma antibody is a growth factor that plays a crucial role in the immune response. This antibody specifically targets and neutralizes interferon-gamma, a key cytokine involved in immune regulation. The IFN gamma antibody is produced using advanced techniques such as electrophoresis and lyophilization, ensuring its high purity and stability. It can be used in various research applications in the field of Life Sciences, including immunological studies and cell culture experiments. This monoclonal antibody has been extensively tested for its specificity and potency, making it a reliable tool for researchers studying the role of interferon-gamma in different biological processes. With its high affinity and selectivity, the IFN gamma antibody provides valuable insights into the complex mechanisms of immune activation and regulation.

Factor VIII antibody (HRP) was raised in sheep using human Factor VIII purified from concentrate as the immunogen.

KTN1 antibody was raised in Rabbit using Human KTN1 as the immunogen

HHIPL1 antibody was raised in rabbit using the C terminal of HHIPL1 as the immunogen

The PECAM1 antibody is a highly specialized monoclonal antibody derived from a hybridoma cell line. It is designed to target and neutralize the growth factor receptor protein known as platelet endothelial cell adhesion molecule 1 (PECAM1). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.

Purified Polyclonal ZNF25 antibody

Affinity purified Rabbit polyclonal HSD17B4 antibody

Rabbit polyclonal RANBP3L antibody

The BclxL antibody is a monoclonal antibody that belongs to the class of anti-acth antibodies. It is widely used in Life Sciences research for its ability to detect and target the BclxL protein, a key regulator of apoptosis. This antibody has been shown to exhibit cytotoxic activity against cancer cells by inducing apoptosis through the inhibition of BclxL function. Additionally, it has been found to have inhibitory effects on chemokine and TGF-beta signaling pathways, which play crucial roles in inflammation and immune response. The BclxL antibody can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. Its high specificity and affinity make it a valuable tool for studying the role of BclxL in cell survival and growth regulation.

ARPC4 antibody was raised in Rabbit using Human ARPC4 as the immunogen

The Ovalbumin antibody is a polyclonal antibody that specifically targets the ovalbumin protein. Ovalbumin is a basic protein found in egg whites and is commonly used in life sciences research as a model antigen. This antibody has been developed to bind to the CD3 receptor, which is expressed on T cells, making it an ideal tool for studying T cell activation and function. The Ovalbumin antibody is reactive and can be used in various applications such as immunohistochemistry, flow cytometry, and Western blotting. It can also be used as a diagnostic reagent for detecting ovalbumin or related proteins in human serum samples. Additionally, this antibody has neutralizing properties and can inhibit the activity of TNF-related apoptosis-inducing ligand (TRAIL), making it a valuable tool for studying cell death pathways. With its high specificity and affinity, the Ovalbumin antibody is an essential tool for researchers working in the field of immunology and molecular biology.

Affinity purified Rabbit polyclonal Calpain 5 antibody

GSTA3 antibody was raised in Rabbit using Human GSTA3 as the immunogen

TPI1 antibody was raised using the N terminal of TPI1 corresponding to a region with amino acids MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID