Anticorps primaires

Glycoprotein Ib antibody was raised using a synthetic peptide corresponding to a region with amino acids RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS

Affinity purified Rabbit polyclonal DLD antibody

Rabbit polyclonal CYB5 antibody (HRP)

MAOA antibody was raised using the middle region of MAOA corresponding to a region with amino acids NINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSE

Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.

Mouse monoclonal SH2D2A antibody

STK11 antibody was raised using the N terminal of STK11 corresponding to a region with amino acids TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE

CD122 antibody (Azide free) was raised in rat using rat myeloma YB2/0 transfected with truncated murine IL-2RB cDNA as the immunogen.

Rabbit polyclonal CYP2A13 antibody

The APRIL antibody is a growth factor that plays a crucial role in endothelial growth and low-density lipoprotein (LDL) glycation. It is widely used in the field of Life Sciences for research purposes. This antibody specifically targets APRIL, which is a member of the tumor necrosis factor (TNF) superfamily. By binding to APRIL, this antibody inhibits its activity and prevents its interaction with other receptors.

Mouse monoclonal MTMR14 antibody

PERK antibody was raised in Rabbit using Human PERK as the immunogen

The Pirimiphos antibody is a highly effective antibody-drug that specifically targets TNF-α, a cytokine involved in inflammation and immune response. This polyclonal antibody is widely used in Life Sciences research to study the role of TNF-α and its receptor in various biological processes. It can be used for applications such as immunohistochemistry and Western blotting to detect and quantify TNF-α expression levels. The Pirimiphos antibody can also be conjugated with other molecules, such as doxorubicin, to create targeted therapies for specific diseases. With its high specificity and affinity, this monoclonal antibody offers a powerful tool for researchers studying growth factors, kinases, phosphatases, and carbonyl reductases. Its cytotoxic properties make it an ideal candidate for therapeutic applications aimed at eliminating cells expressing TNF-α.

The EGF antibody is a monoclonal antibody that specifically targets and neutralizes the activity of epidermal growth factor (EGF). This antibody is widely used in Life Sciences research for its ability to inhibit the binding of EGF to its receptor, preventing downstream signaling pathways that promote cell proliferation and survival. The EGF antibody can be immobilized on streptavidin-coated surfaces or used in solution-based assays. It has been shown to be cytotoxic towards cells that rely heavily on EGF signaling for their growth and survival. Additionally, this antibody has been used in studies to investigate the role of EGF in various biological processes, such as wound healing and cancer progression. With its high specificity and affinity for EGF, the EGF antibody is an invaluable tool for researchers studying the effects of this growth factor and developing potential therapeutic inhibitors.

The A2M antibody is a powerful inhibitor of vascular endothelial growth factor (VEGF), which plays a crucial role in angiogenesis. It is also effective against other growth factors such as alpha-fetoprotein and erythropoietin. In addition, this antibody has been shown to inhibit the growth of Helicobacter, a bacteria that causes gastric ulcers. The A2M antibody works by binding to calmodulin, a protein involved in cell signaling, and preventing its activation. This inhibition leads to antiangiogenic effects and reduces the acidic environment necessary for tumor growth. Furthermore, the A2M antibody has anticoagulant properties that can be beneficial for patients with conditions such as heparin-induced thrombocytopenia. With its wide range of applications in life sciences, this polyclonal antibody is an essential tool for researchers and scientists working in various fields.

entB Monoclonal Antibody Biotin

GCLM antibody was raised using the middle region of GCLM corresponding to a region with amino acids KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ

OCT4 antibody was raised in Mouse using a purified recombinant fragment of OCT4(aa193-360) expressed in E. coli as the immunogen.