Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.620 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(751 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.551 produits)
- Anticorps du métabolisme(279 produits)
- Anticorps de microbiologie(739 produits)
- Transduction du signal(2.717 produits)
- Tags & Marqueurs cellulaires(33 produits)
75447 produits trouvés pour "Anticorps primaires"
FABP antibody
The FABP antibody is a growth factor that targets adipose tissue. It is a monoclonal antibody specifically designed to bind to fatty acid binding proteins (FABPs). FABPs play a crucial role in the transport and metabolism of fatty acids within cells. By targeting FABPs, this antibody can modulate their activity and potentially impact various cellular processes.CYP2J2 antibody
The CYP2J2 antibody is a highly specialized monoclonal antibody that targets β-catenin, a key protein involved in cell adhesion and signaling pathways. This antibody specifically inhibits the activation of chemokine receptors, which are important for immune cell recruitment and inflammation. It has been extensively studied as a potential therapeutic target for various diseases, including cancer and cardiovascular disorders.
BMX antibody
BMX antibody was raised in Mouse using a purified recombinant fragment of human BMX expressed in E. coli as the immunogen.
CMV ICP36 antibody
CMV ICP36 antibody was raised in mouse using cytomegalovirus major DNA binding protein ICP36 as the immunogen.KIAA0692 antibody
KIAA0692 antibody was raised using the middle region of Kiaa0692 corresponding to a region with amino acids CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG
IDH1 antibody
IDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQ
RHPN1 antibody
RHPN1 antibody was raised using the middle region of RHPN1 corresponding to a region with amino acids SAKNRWRLVGPVHLTRGEGGFGLTLRGDSPVLIAAVIPGSQAAAAGLKEG
Osteopontin antibody
The Osteopontin antibody is a highly effective monoclonal antibody that targets the protein osteopontin. It is specifically designed to bind to this protein and inhibit its activity. Osteopontin is involved in various biological processes, including cell adhesion, migration, and inflammation. By targeting osteopontin, this antibody can potentially have therapeutic applications in various diseases, including cancer and autoimmune disorders.
