Anticorps primaires

Sheep polyclonal Ketoprofen antibody

Rabbit polyclonal PSMB1 antibody (HRP)

ApoB antibody was raised in mouse using human serum LDL as the immunogen.

NUDT18 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASEGLAGALASVLAGQGSSVHSCDSAPAGEPPAPVRLRKNVCYVVLAVF

Complement C2 antibody was raised using the N terminal of C2 corresponding to a region with amino acids EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS

TMCC1 antibody was raised using the middle region of TMCC1 corresponding to a region with amino acids YQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARNLLGK

Rabbit polyclonal TNFSF9 antibody (HRP)

KRT8 antibody was raised in Rabbit using Human KRT8 as the immunogen

ZKSCAN1 antibody was raised in rabbit using the N terminal of ZKSCAN1 as the immunogen

Mouse monoclonal Cytokeratin 5 + 8 antibody

Mouse monoclonal PPP1CB antibody

Rabbit monoclonal VEGF antibody (biotin)

The PPIA antibody is a monoclonal antibody that specifically targets the extracellular domain of the protein peptidylprolyl isomerase A (PPIA). PPIA is an enzyme that plays a crucial role in protein folding and is involved in various cellular processes, including interleukin signaling and antiviral defense. The PPIA antibody has been extensively studied and shown to have high affinity binding to PPIA, making it a valuable tool for research in the Life Sciences field.

Rabbit polyclonal RIOK3 antibody

CD22 antibody was raised in rat using CD22 as the immunogen.

SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen

Lipocalin 12 antibody was raised using the N terminal of LCN12 corresponding to a region with amino acids GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG

The PAK1 antibody is a cytotoxic agent that targets the PAK1 isoenzyme. It belongs to the group of Polyclonal Antibodies, which are widely used in Life Sciences research. This antibody specifically binds to PAK1 and inhibits its activity, making it an essential tool for studying the role of PAK1 in various cellular processes. The PAK1 antibody can be used in experiments involving collagen, epidermal growth factor, hepatocyte growth factor, and other related molecules. It is available as a monoclonal antibody, ensuring high specificity and reproducibility in experiments. Additionally, this antibody has been shown to be activated in the presence of certain autoantibodies and levothyroxine, making it a versatile tool for multiple applications.