Anticorps primaires

Rabbit polyclonal VOPP1 antibody (FITC)

Rel antibody is a highly specialized product used in Life Sciences research. It is a polyclonal antibody that specifically targets and neutralizes the epidermal growth factor (EGF). This antibody is produced using state-of-the-art technology and contains high-quality excipients to ensure stability and efficacy. Rel antibody has been extensively tested and validated for use in various applications, including ELISA assays, Western blotting, immunohistochemistry, and more. It is highly specific and exhibits strong binding affinity towards EGF, making it a valuable tool for studying EGF-related signaling pathways. Whether you're investigating the role of EGF in cancer development or exploring its effects on insulin signaling, Rel antibody is an essential component of your research toolkit. Trust in its reliability and accuracy to enhance your scientific discoveries.

The HCG beta Antibody is a specific monoclonal antibody that is commonly used in Life Sciences research. It has been extensively studied and proven to be highly effective in various applications. This antibody specifically targets the influenza hemagglutinin, which plays a crucial role in receptor binding and viral entry.

Rabbit polyclonal MAD4 antibody

The PYK2 antibody is a highly specific monoclonal antibody that targets PYK2, a tyrosine kinase protein involved in various cellular processes. This antibody has been extensively tested and validated for its ability to neutralize the activity of PYK2, making it an invaluable tool for researchers studying signal transduction pathways and cell signaling mechanisms. The PYK2 antibody can be used in a variety of applications, including Western blotting, immunoprecipitation, immunofluorescence, and flow cytometry. It is available as both a purified monoclonal antibody and as part of a kit that includes all the necessary reagents for successful experiments. With its high specificity and sensitivity, the PYK2 antibody is an essential tool for any researcher working with PYK2-related studies.

JAK2 antibody was raised in Mouse using a purified recombinant fragment of JAK2(745-955aa) expressed in E. coli as the immunogen.

SCYL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGSENSALKSYTLREPPFTLPSGLAVYPAVLQDGKFASVFVYKRENEDKV

KCTD14 antibody was raised in Rabbit using Human KCTD14 as the immunogen

ZDHHC17 antibody was raised using the middle region of ZDHHC17 corresponding to a region with amino acids FLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPL

The p27Kip1 antibody is a highly specialized tool used in the field of Life Sciences. It is an activated electrode that specifically targets and binds to p27Kip1, a protein involved in cell cycle regulation. This monoclonal antibody is designed to recognize and bind to p27Kip1 with high affinity and specificity, making it an essential tool for researchers studying cellular processes.

Rabbit polyclonal ST8SIA2 antibody

Purified Polyclonal GNG8 antibody

MCM2 antibody was raised in Rabbit using Human MCM2 as the immunogen

Rabbit anti-rat IgG (H+L) (HRP) was raised in rabbit using rat IgG whole molecule as the immunogen.

hCG beta antibody is a glycosylated monoclonal antibody that acts as a growth factor inhibitor. It has the ability to neutralize the activity of hCG beta, which is involved in various biological processes such as pregnancy and tumor growth. This antibody specifically targets the influenza hemagglutinin and inhibits its function, thereby preventing viral entry into host cells. Additionally, hCG beta antibody has been shown to inhibit protein kinase activity and interfere with interferon signaling pathways. It also exhibits necrosis factor-related apoptosis-inducing properties, promoting cell death in activated cells. With its unique characteristics and mechanisms of action, hCG beta antibody is a valuable tool for research and therapeutic applications.

Mouse monoclonal SH2D2A antibody