Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.620 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(751 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.551 produits)
- Anticorps du métabolisme(279 produits)
- Anticorps de microbiologie(739 produits)
- Transduction du signal(2.717 produits)
- Tags & Marqueurs cellulaires(33 produits)
75447 produits trouvés pour "Anticorps primaires"
ARAF antibody
The ARAF antibody is a highly specialized monoclonal antibody that targets and neutralizes the ARAF protein. This protein plays a crucial role in cell growth and division, making it an important target for cancer therapy. The ARAF antibody binds to the ARAF protein, preventing its activation and inhibiting tumor growth.
MMP1 antibody
MMP1 antibody was raised in mouse using a synthetic peptide (VQGQNVLHGYPKDIYSSFG) corresponding to amino acid residues 332-350 0f human MMP-1 as the immunogen.
ZC3H12A antibody
The ZC3H12A antibody is a polyclonal antibody that is used in life sciences research. It has been shown to interact with various proteins and molecules, including alpha-fetoprotein, macrophage colony-stimulating factor, interferon, phosphatase, acidic glutamate, and vasoactive intestinal peptide. This antibody is commonly used in studies related to immune response and cell signaling pathways. It specifically targets the ZC3H12A protein, which is known to play a role in regulating inflammatory responses. The ZC3H12A antibody can be used for various applications such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). Its high specificity and sensitivity make it a valuable tool for researchers studying immune system function and related diseases.
SGSH antibody
The SGSH antibody is a highly specialized antibody that targets sulfatase, an enzyme involved in the breakdown of complex molecules called glycosaminoglycans (GAGs). This antibody specifically recognizes and binds to the sulfatase nucleotide-binding site, inhibiting its activity.
KCTD13 antibody
KCTD13 antibody was raised using the N terminal of KCTD13 corresponding to a region with amino acids PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE
BRCA2 antibody
The BRCA2 antibody is a highly specific monoclonal antibody that is used in Life Sciences research. It specifically targets the BRCA2 protein, which is involved in DNA repair and maintenance of genomic stability. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry. It has been shown to have high affinity and specificity for the BRCA2 protein, making it a valuable tool for studying its function and regulation. Additionally, this antibody does not cross-react with other proteins such as transferrin, alpha-fetoprotein, collagen, or lipoprotein lipase, ensuring accurate and reliable results. Whether you are studying DNA repair mechanisms or investigating the role of BRCA2 in cancer development, this BRCA2 antibody will provide you with the precise and reliable data you need for your research.
