Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.620 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(751 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.551 produits)
- Anticorps du métabolisme(279 produits)
- Anticorps de microbiologie(739 produits)
- Transduction du signal(2.717 produits)
- Tags & Marqueurs cellulaires(33 produits)
75447 produits trouvés pour "Anticorps primaires"
Cytokeratin 4+5+6+8+10+13+18 antibody (Prediluted for IHC)
Mouse monoclonal Cytokeratin 4+5+6+8+10+13+18 antibody (Prediluted for IHC)
Degré de pureté :Min. 95%Pseudorabies Virus antibody
Pseudorabies Virus antibody is a vital tool in the field of Life Sciences. It is a polyclonal antibody that can be used for various applications. This antibody specifically targets the Pseudorabies Virus, which is a highly contagious viral disease that affects animals, especially pigs. The Pseudorabies Virus antibody can be used in research studies to detect and quantify the presence of the virus in samples.
AFP antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication in bacteria. Its effectiveness has been demonstrated through patch-clamp techniques on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.HAVCR1 antibody
HAVCR1 antibody was raised using the N terminal of HAVCR1 corresponding to a region with amino acids CHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSRDegré de pureté :Min. 95%ARD1A antibody
ARD1A antibody was raised using a synthetic peptide corresponding to a region with amino acids VESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSE
CD79b antibody (PE)
CD79b antibody (biotin) was raised in hamster using the beta chain of the murine B-cell receptor as the immunogen.
Degré de pureté :Min. 95%WDR1 antibody
WDR1 antibody was raised using the C terminal of WDR1 corresponding to a region with amino acids LAWSPDNEHFASGGMDMMVYVWTLSDPETRVKIQDAHRLHHVSSLAWLDE
ADP ribosylation factor 3 antibody
Affinity purified Rabbit polyclonal ADP ribosylation factor 3 antibody
