Anticorps primaires

The KRT8 antibody is a monoclonal antibody that specifically targets Keratin 8 (KRT8), a protein found in epithelial tissues. This antibody has been extensively studied and has shown promising results in various fields of research, particularly in the life sciences.

The CD45RO antibody is a monoclonal antibody that specifically targets the CD45RO protein, which is expressed on activated T cells and memory T cells. This antibody has been extensively studied in the field of Life Sciences and has shown inhibitory effects on interleukin-6 (IL-6) signaling pathway and p38 MAPK activation. It has also been shown to inhibit syncytia formation, a process involved in viral infection.

GJC3 antibody was raised in rabbit using the middle region of GJC3 as the immunogen

The CD44 antibody is a monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to CD44, a cell surface glycoprotein that plays a crucial role in cell adhesion and migration. This antibody has been extensively studied for its ability to inhibit the growth and metastasis of various types of cancer cells.

Rabbit polyclonal NPEPL1 antibody

IL10 antibody is a medicament that belongs to the class of antibodies. It is a protein complex that specifically targets and binds to IL10, a cytokine involved in immune regulation. IL10 antibody can be used as a therapeutic agent for various diseases characterized by excessive IL10 activity, such as autoimmune disorders and inflammatory conditions. This monoclonal antibody has been extensively studied in the field of Life Sciences and has shown promising results in preclinical and clinical trials. It has the ability to neutralize the effects of IL10, thereby reducing its immunosuppressive and anti-inflammatory properties. IL10 antibody is also being investigated for its potential antiviral activity and its ability to enhance the effectiveness of multidrug therapies.

Affinity purified Rabbit polyclonal NEGR1 antibody

Rabbit polyclonal TUBB3 antibody (FITC)

DEFB4A antibody was raised in rabbit using the N terminal of DEFB4A as the immunogen

ZHX2 antibody was raised in rabbit using the C terminal of ZHX2 as the immunogen

CATSPER2 antibody was raised using the N terminal of CATSPER2 corresponding to a region with amino acids HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA

The MELK antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize the activity of Maternal Embryonic Leucine Zipper Kinase (MELK), a nuclear protein that plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in inhibiting the growth and proliferation of cancer cells.

Rabbit polyclonal PRPSAP2 antibody

DLC1 antibody was raised using the C terminal of DLC1 corresponding to a region with amino acids NLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGL

CKMM antibody was raised using the N terminal of CKM corresponding to a region with amino acids VGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDL

The SCAP antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that can be used for immobilization on electrodes, making it ideal for various research applications. This antibody specifically targets and binds to SCAP (Sterol Regulatory Element-Binding Protein Cleavage-Activating Protein), which plays a crucial role in cholesterol metabolism and lipid homeostasis. By targeting SCAP, researchers can gain valuable insights into the regulation of these processes.

MRPS2 antibody was raised using the N terminal of MRPS2 corresponding to a region with amino acids MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIR

The STAT1 antibody is a powerful tool used in Life Sciences research for studying cellular signaling pathways and immune responses. It specifically targets the signal transducer and activator of transcription 1 (STAT1) protein, which plays a crucial role in mediating the effects of interferons and other cytokines.

METTL2B antibody was raised using the N terminal of METTL2B corresponding to a region with amino acids INAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNHLKDWFLENKS