Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.620 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(751 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.551 produits)
- Anticorps du métabolisme(279 produits)
- Anticorps de microbiologie(739 produits)
- Transduction du signal(2.717 produits)
- Tags & Marqueurs cellulaires(33 produits)
75447 produits trouvés pour "Anticorps primaires"
PPIL2 antibody
PPIL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQ
FOXP2 antibody
The FOXP2 antibody is a highly specialized microparticle used in Life Sciences research. It is a polyclonal antibody that specifically targets the FOXP2 protein, which plays a crucial role in various cellular processes. This antibody can be used in applications such as transcription-polymerase chain reaction (PCR), interferon assays, and antigen-antibody reactions.
Degré de pureté :Min. 95%Heparin antibody
Heparin antibody is a monoclonal antibody that is used to detect and diagnose heparin-induced thrombocytopenia (HIT), a condition in which the body's immune system produces antibodies against heparin, a commonly used blood thinner. This antibody specifically targets the complex formed between heparin and platelet factor 4 (PF4), which is responsible for the immune response leading to HIT. Heparin antibody can also be used in research settings to study the interactions between heparin and other molecules, such as insulin. Additionally, this antibody has been used in the development of therapeutic monoclonal antibodies, such as trastuzumab, which is used to treat certain types of cancer. Its high specificity and sensitivity make it a valuable tool in various applications within the field of life sciences.
CD8 antibody (Spectral Red)
CD8 antibody (Spectral Red) was raised in mouse using human CD8 as the immunogen.
LOC400856 antibody
LOC400856 antibody was raised using the C terminal of LOC400856 corresponding to a region with amino acids SLHTSPRAEGAGSGLSQPQRRALTAQGGAEGLLERGQSGHGGRGGAKSER
Chromogranin A antibody
Chromogranin A antibody was raised in mouse using human pheochromocytoma as the immunogen.
SLC26A10 antibody
SLC26A10 antibody was raised in rabbit using the N terminal of SLC26A10 as the immunogen
Degré de pureté :Min. 95%GLP1 antibody
The GLP1 antibody is a monoclonal antibody that acts as an immunosuppressant. It targets specific molecules such as alpha-fetoprotein, calmodulin, and angptl3, inhibiting their activity. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in neutralizing the effects of these molecules. Additionally, it has been found to have an inhibitory effect on phosphatase activity. The GLP1 antibody can be used in various applications, including research studies and therapeutic interventions. Its unique properties make it a valuable tool for investigating adipose tissue biology, colloidal chemistry, chemokine signaling pathways, and human serum analysis. With its high specificity and efficacy, this antibody is an essential component for any laboratory or research facility looking to advance their understanding of these biological processes.EPHA3 antibody
The EPHA3 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It targets the fatty acid receptor EPHA3, which plays a crucial role in various cellular processes such as cell growth and differentiation. This antibody has been extensively studied and validated for its ability to specifically bind to EPHA3, making it an essential tool for researchers working in this area.
Bin1 antibody
Bin1 antibody was raised in rabbit using the N terminal of Bin1 as the immunogen
Degré de pureté :Min. 95%CD19 antibody (Azide Free)
CD19 antibody (Azide free) was raised in mouse using human CD19 as the immunogen.
