Inhibiteurs
Les inhibiteurs sont des molécules qui se lient aux enzymes, récepteurs ou autres protéines pour réduire ou bloquer leur activité biologique. Ces composés sont largement utilisés en recherche pour étudier les voies biologiques, comprendre les mécanismes des maladies et développer des médicaments thérapeutiques. Les inhibiteurs jouent un rôle crucial dans le traitement de diverses maladies, y compris le cancer, les maladies cardiovasculaires et les infections. Chez CymitQuimica, nous offrons une large gamme d'inhibiteurs de haute qualité pour soutenir vos recherches en biochimie, biologie cellulaire et développement pharmaceutique.
Sous-catégories appartenant à la catégorie "Inhibiteurs"
- Angiogenèse(2.850 produits)
- Apoptose(6.367 produits)
- Cycle cellulaire/point de contrôle(4.909 produits)
- Chromatine/Épigénétique(2.631 produits)
- Signalisation du cytosquelette(1.586 produits)
- Altération de l'ADN/réparation de l'ADN(2.868 produits)
- Endocrinologie/Hormones(3.765 produits)
- Enzyme(3.673 produits)
- GPCR/G-Protéine(9.053 produits)
- Immunologie et Inflammation(3.946 produits)
- Virus de la grippe(300 produits)
- Signalisation JAK/STAT(417 produits)
- Signalisation MAPK(1.259 produits)
- Transporteur membranaire/Canal ionique(3.163 produits)
- Métabolisme(10.156 produits)
- Microbiologie/Virologie(7.671 produits)
- Neuroscience(10.551 produits)
- Autres inhibiteurs(35.855 produits)
- Oxydation-Réduction(41 produits)
- Signalisation PI3K/Akt/mTOR(1.435 produits)
- Protéases/Protéasome(1.692 produits)
- Cellules souche et Dérivés(733 produits)
- Tyrosine Kinase/Adaptateurs(1.989 produits)
- Ubiquitination(1.744 produits)
Affichez 16 plus de sous-catégories
66515 produits trouvés pour "Inhibiteurs"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Nucleoprotein (118-126)
CAS :Nucleoprotein (118-126),a fragment of Nucleoprotein, is a 9-aa peptide .Formule :C43H69N13O13SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :1008.15VH 032 amide-PEG4-amine
CAS :VHL ligand for PROTAC R&D with PEG linker; used for protein conjugation. Formerly VH 032 - linker 2. Trademark of Arvinas.Formule :C32H51Cl2N5O8SCouleur et forme :SolidMasse moléculaire :736.75Bis-Mal-PEG7
Bis-Mal-PEG7 is a PEG-based linker for PROTACs which joins two essential ligands, crucial for forming PROTAC molecules.Formule :C30H46N4O13Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :670.712,3-Dihydropodocarpusflavone A
CAS :2,3-Dihydropodocarpusflavone A is a natural product for research related to life sciences. The catalog number is TN2699 and the CAS number is 852875-96-8.Formule :C31H22O10Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :554.5Ganoderic acid X
CAS :Ganoderic acid X is a potential Mdm2 inhibitor(K(i) = 16nM). It is a potential anticancer drug, inhibits topoisomerases and induces apoptosis of cancer cells.Formule :C32H48O5Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :512.731Human PD-L1 inhibitor II
CAS :Human PD-L1 inhibitor II is a potent PD-L1 inhibitor with anti-cancer activity.Formule :C103H151N25O30Couleur et forme :SolidMasse moléculaire :2219.486MCA-SEVNLDAEFR-K(Dnp)-RR, amide
CAS :MCA-SEVNLDAEFR-K(Dnp)-RR, amide is a FRET-based substrate.Formule :C86H125N27O29Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :2001.08CooP
CAS :CooP is a nonapeptide targeting glioblastoma. It binds to FABP3 for chemotherapy delivery.Formule :C32H57N9O11SCouleur et forme :SolidMasse moléculaire :775.91Human growth hormone-releasing factor TFA
Human growth hormone-releasing factor TFA is a hypothalamic peptide that promotes GH secretion by targeting pituitary GHRHR.Formule :C217H359F3N72O68SCouleur et forme :SolidMasse moléculaire :5153.67Hydroxy-PEG12-acid
Hydroxy-PEG12-acid is a PEG-based linker for PROTACs which joins two essential ligands, crucial for forming PROTAC molecules.Formule :C27H54O15Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :618.71(R)-Isomucronulatol
CAS :(R)-Isomucronulatol, from Astragalus and others, may stop BMSC growth and death, suggesting anti-inflammatory properties.Formule :C17H18O5Degré de pureté :99.89%Couleur et forme :SolidMasse moléculaire :302.32pBD-1
CAS :pBD-1: Endogenous AMP in pigs, expressed constitutively in mucosal epithelia for host defense.Formule :C310H543N91O73S11Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :7065.98Zinniol
CAS :Zinniol is a natural product that can be used as a reference standard. The CAS number of Zinniol is 17811-28-8.Formule :C15H22O4Couleur et forme :SolidMasse moléculaire :266.337Malantide TFA
Malantide TFA: synthetic dodecapeptide, PKA-specific with Km 15 μM, >90% PKI blockage, also PKC substrate, Km 16 μM.Formule :C74H125F3N22O23Couleur et forme :SolidMasse moléculaire :1747.91Neuropeptide SF(mouse,rat) TFA
Neuropeptide SF TFA is a potent agonist for NPFF1 (Ki=48.4 nM) and NPFF2 (Ki=12.1 nM) and enhances ASIC3 current.Formule :C42H66F3N13O12Couleur et forme :SolidMasse moléculaire :1002.05SNIPER(ABL)-015
SNIPER(ABL)-015, a compound that conjugates GNF5 (ABL inhibitor) to MV-1 (IAP ligand) via a linker, effectively reduces BCR-ABL protein levels with a DC50 of 5Formule :C58H70F3N9O9Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1094.23H-Gly-Pro-Gly-NH2
CAS :H-Gly-Pro-Gly-NH2, a tripeptide, inhibits HIV-1 and HIV-2 replication (EC50: 35µM, 30µM) by blocking capsid formation.
Formule :C9H16N4O3Couleur et forme :SolidMasse moléculaire :228.254-Methoxy-1-methylquinolin-2-one
CAS :4-Methoxy-1-methylquinolin-2-one is a natural product from Zanthoxylum nitidum.Formule :C11H11NO2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :189.21HAE acetate(64111-99-5 free base)
HAE acetate is a 3-amino acid peptide composed of histidine, alanine and glutamateFormule :C16H25N5O8Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :415.4Lys-P-1
CAS :Lys-P-1 is a bioactive chemical.Formule :C18H14N2Couleur et forme :SolidMasse moléculaire :258.32Compound 0080-0053
Compound 0080-0053 is a useful organic compound for research related to life sciences and the catalog number is T131693.Formule :C24H34N2O4Couleur et forme :SolidMasse moléculaire :414.546PPIase-Parvulin Inhibitor
CAS :PPIase-Parvulin Inhibitor is a cell-pemeable inhibitor of the Pin1 and Pin4.Formule :C22H18N2O8Degré de pureté :97.76% - 99.21%Couleur et forme :SolidMasse moléculaire :438.39ddTTP
CAS :ddTTP, a 2',3'-dideoxyribonucleoside 5'-triphosphate (ddNTP), serves as a chain-elongation inhibitor of DNA polymerase in DNA sequencing [1].Formule :C10H17N2O13P3Couleur et forme :SolidMasse moléculaire :466.17HO-PEG-amine (MW 1000)
HO-PEG-amine (MW 1000) is a PEG-based linker for PROTACs which joins two essential ligands, crucial for forming PROTAC molecules.Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :N/AErythro-Guaiacylglycerol β-coniferyl ether
CAS :Erythro-Guaiacylglycerol beta-coniferyl ether is a compound that can be extracted from the stems and leaves of mung beans and has inhibitory effects on alpha-Formule :C20H24O7Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :376.4Lancifolin C
CAS :Lancifolin C is a natural product of Piper, Piperaceae.Formule :C22H28O5Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :372.45JAK3-IN-14
CAS :JAK3-IN-14 is a potent, selective and orally active FLT3 inhibitor, with IC50s of ∼40, 8, and 4 nM for FLT3-WT, FLT3-D835Y, and FLT3-D835H, respectively.Formule :C18H13N3ODegré de pureté :98.29%Couleur et forme :SoildMasse moléculaire :287.32Ref: TM-T67754
1mg167,00€1mL*10mM (DMSO)358,00€5mg409,00€10mg595,00€25mg888,00€50mg1.234,00€100mg1.665,00€Utreglutide
CAS :Utreglutide is a potent glucagon-like peptide 1 (GLP-1) receptor agonit [1] .Formule :C191H298N46O58Couleur et forme :SolidMasse moléculaire :4166.67LLO (91-99)
CAS :LLO (91-99), a T-cell epitope from listeriolysin, is critical for T-cell immunity.Formule :C47H67N11O17Couleur et forme :SolidMasse moléculaire :1058.113BCN-SS-NHS
BCN-SS-NHS is a cleavable linker vital in ADC synthesis.Formule :C20H26N2O6S2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :454.56TAT-Gap19 TFA
TAT-Gap19 TFA is a peptide that inhibits Cx43 hemichannels but not gap junctions and may reduce liver fibrosis.Formule :C121H213F3N46O28Couleur et forme :SolidMasse moléculaire :2817.27LY-402913
CAS :LY-402913 is a selective multidrug resistance protein (MRP1) inhibitor.Formule :C28H24ClN3O6Degré de pureté :99.73%Couleur et forme :SolidMasse moléculaire :533.96Ref: TM-T27954
1mg109,00€2mg163,00€5mg241,00€1mL*10mM (DMSO)304,00€10mg355,00€25mg532,00€50mg745,00€100mg1.018,00€DAPK Substrate Peptide TFA
DAPK Substrate Peptide TFA is a synthetic peptide that serves as a substrate for the enzyme death-associated protein kinase (DAPK), exhibiting a MichaelisFormule :C72H116F3N25O19Couleur et forme :SolidMasse moléculaire :1692.84Mal-amido-PEG9-acid
CAS :Mal-amido-PEG9-acid is a PEG-based linker for PROTACs which joins two essential ligands, crucial for forming PROTAC molecules.Formule :C28H48N2O14Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :636.69Equilenin
CAS :Equilenin (E 400) is a natural estrogen that is an endocrine disruptor and has been used in breast cancer research.Formule :C18H18O2Degré de pureté :99.4%Couleur et forme :SolidMasse moléculaire :266.33Spexin TFA
Spexin TFA: GAL2/GAL3 agonist (EC50: 45.7/112.2 nM), no activity at GAL1, reduces appetite, fatty acid uptake, and LH secretion; anxiolytic.Formule :C76H115F3N20O21SCouleur et forme :SolidMasse moléculaire :1733.9δ-Buthitoxin-Hj1a
δ-Buthitoxin-Hj1a, a scorpion-venom peptide, functions as a potent agonist for the NaV1.1 channel, exhibiting an EC50 value of 17 nM.Formule :C326H482N92O96S8Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :7482.39Zetidoline
CAS :Zetidoline is a biochemicla.Formule :C16H22ClN3OCouleur et forme :SolidMasse moléculaire :307.82Amine-PEG-thiol (MW 2000)
Amine-PEG-thiol (MW 2000) is a PEG-based PROTAC linker employed in PROTAC synthesis[1].Couleur et forme :Solidβ-Defensin-4 (human) (trifluoroacetate salt)
CAS :β-Defensin-4 is a peptide with antimicrobial properties that protects the skin and mucosal membranes of the respiratory, genitourinary, and gastrointestinalFormule :C180H295N63O52S6xCF3COOHCouleur et forme :SolidMasse moléculaire :4366.1Maculatin 1.1 TFA
Maculatin 1.1 TFA, an antimicrobial peptide, exhibits a minimum inhibitory concentration (MIC) of 7 μM against Staphylococcus aureus and induces bacterialCouleur et forme :Odour SolidMumeose K
CAS :Mumeose K is a natural product for research related to life sciences. The catalog number is TN5846 and the CAS number is 2132384-01-9.Formule :C25H32O15Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :572.516C-Type Natriuretic Peptide (1-22) acetate(human)
CNP (1-22), human acetate, NPR-B agonist, inhibits cAMP synthesis, counters histamine and 5-HT effects.Formule :C97H162F3N27O32S3Degré de pureté :95.95%Couleur et forme :SolidMasse moléculaire :2371.68CALP2 TFA
CALP2 TFA, a CaM antagonist with 7.9 µM Kd, blocks CaM-dependent enzymes, boosts Ca2+ levels, and activates macrophages.Formule :C70H105F3N14O15SCouleur et forme :SolidMasse moléculaire :1471.72Real Thiol
CAS :Real Thiol, a reversible reaction-based fluorescent probe, can quantitatively monitor the real-time glutathione dynamics in living cells.Formule :C20H17N3O7Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :411.37THP-PEG4-Pyrrolidine(N-Me)-CH2OH
CAS :THP-PEG4-Pyrrolidine(N-Me)-CH2OH, a PEG-based PROTAC linker, facilitates the synthesis of PROTAC K-Ras Degrader-1[1].Formule :C19H37NO7Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :391.5Guvacine hydrobromide
CAS :Guvacine hydrobromide, an alkaloid derived from the Areca catechu nut, serves as a potent inhibitor of GABA (GABA uptakp) uptake.Formule :C6H10BrNO2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :208.05Hedycoronen A
CAS :Hedycoronen A/B inhibit IL-6/IL-12, IC50=4.1-9.1 uM & TNF-α, IC50=12.7-46.0 uM, promising anti-inflammatory agents.Formule :C21H30O3Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :330.46Neuropeptide Y (3-36) (porcine)
CAS :Neuropeptide Y (3-36) (porcine) is a potent, selective agonist at NPY Y2 receptors, increasing feeding in rats.Formule :C176H271N53O54Couleur et forme :SolidMasse moléculaire :3993.36NHPI-PEG4-C2-Pfp ester
CAS :NHPI-PEG4-C2-Pfp ester is used as a linker for antibody-drug conjugates (ADC).Formule :C25H24F5NO9Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :577.45Enpp/Carbonic anhydrase-IN-2
CAS :Enpp/Carbonic anhydrase-IN-2 is a potent dual inhibitor of Enpp and carbonic anhydrase, inhibiting NPP1, NPP2, NPP3, CA-IX, CA-XII, with IC50 values of 1.13, 1.Formule :C23H24FNO4SDegré de pureté :99.46%Couleur et forme :SoildMasse moléculaire :429.5Ref: TM-T77631
1mg44,00€5mg90,00€1mL*10mM (DMSO)96,00€10mg145,00€25mg236,00€50mg338,00€100mg460,00€200mg622,00€Hydroxy-PEG20-Boc
Hydroxy-PEG20-Boc is a PEG-based linker for PROTACs which joins two essential ligands, crucial for forming PROTAC molecules.Formule :C47H94O23Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1027.24Mal-NH-PEG4-CH2CH2COOPFP ester
CAS :Mal-NH-PEG4-CH2CH2COOPFP ester is a polyethylene glycol (PEG) based linker employed in the synthesis of proteolysis-targeting chimeras (PROTACs)[1].Formule :C24H27F5N2O9Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :582.47Lead phthalocyanine
CAS :Lead phthalocyanine, a selective carrier, can be used for the preparation of a cysteine-selective electrode.Formule :C32H16N8PbCouleur et forme :SolidMasse moléculaire :719.70Betamethasone 17-benzoate
CAS :Betamethasone 17-benzoate is a representative steroid. It also can be used in the treatment of recurrent aphothous ulcers (RAU).Formule :C29H33FO6Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :496.57ACTH (3-24) (human, bovine, mouse, ovine, porcine, rabbit, rat)
CAS :ACTH (3-24) is the fragment 3-24 of ACTH, used in disease research including cancer and immune disorders.Formule :C124H196N38O27SCouleur et forme :SolidMasse moléculaire :2683.19Urgineanin A
CAS :Urgineanin A is a useful organic compound for research related to life sciences. The catalog number is T125870 and the CAS number is 1432501-10-4.Formule :C20H22O7Couleur et forme :SolidMasse moléculaire :374.389TMX-4153
CAS :TMX-4153 is a bivalent degrader that selectively targets and rapidly degrades endogenous PIP4K2C through recruitment of the von Hippel-Lindau (VHL) E3 ligaseFormule :C59H67ClN10O6SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :1079.75SID-852843
CAS :SID-852843, WNV NS2B-NS3 protease inhibitor, IC50: 0.105 μM, useful in viral infection studies.Formule :C17H15N3O5SDegré de pureté :99.59%Couleur et forme :SolidMasse moléculaire :373.38Somatostatin-25
CAS :Somatostatin: a brain/pancreas hormone binding receptors, with anxiolytic, antiepileptic, and appetite-suppressing effects.Formule :C127H191N37O34S3Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :2876.3rGHRH(1-29)NH2
RGHRH (1-29)NH2 is a synthetic peptide that stimulates the secretion of growth hormone (GH).Formule :C155H251N49O40SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :3473.02Velmupressin acetate
CAS :Potent, selective, short-acting peptidic V2R agonist; EC50: 0.07 nM (hV2R), 0.02 nM (rV2R).Formule :C44H64ClN11O10S2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1006.63Platycoside K
CAS :Platycoside K is a natural product for research related to life sciences. The catalog number is TN4805 and the CAS number is 899447-64-4.Formule :C42H68O17Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :844.98γ-1-Melanocyte Stimulating Hormone (MSH), amide
γ-1-Melanocyte Stimulating Hormone (MSH), amide, a peptide consisting of 11 amino acids, plays a critical role in regulating sodium (Na+) balance and bloodFormule :C72H97N21O14SCouleur et forme :SolidMasse moléculaire :1512.9MUC1, mucin core
CAS :MUC1: Type I transmembrane glycoprotein, overexpressed and abnormally glycosylated in cancer, binds ICAM-1 domain 1.Formule :C61H101N19O24Couleur et forme :SolidMasse moléculaire :1484.588Prajmalium bitartrate
CAS :Prajmalium bitartrate, a derivative of the rauwolfia alkaloid AJMALINE, is an anti-arrhythmia agent but may cause liver damage.Formule :C27H38N2O8Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :518.607C-Reactive Protein (CRP) (77-82)
CAS :CRP 77-82 is a fragment of CRP, a pentameric, plasma protein that marks inflammation and cardiovascular risk, rising with IL-6 from macrophages/T cells.
Formule :C23H40N6O10Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :560.615-Glutinen-3-ol
CAS :5-Glutinen-3-ol is a natural product from Clausena excavata.Formule :C30H50ODegré de pureté :98%Couleur et forme :SolidMasse moléculaire :426.72T3 Acyl glucuronide
CAS :T3 Acyl glucuronide is the acyl glucuronide formation of triiodothyronine (T3). T3 Acyl glucuronide is an endogenous metaboliteFormule :C21H20I3NO10Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :827.1Caulophylline B
CAS :Caulophylline B, an alkaloid extracted from the roots of Caulophyllum robustum Maxim, affords a low scavenging effect against DPPH radical.Formule :C19H21NO5Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :343.37Glipentide
CAS :Glieptide, a second-generation sulfonylurea, promotes the accumulation of fructose 2, 6-diphosphate in liver cells.Formule :C22H27N3O5SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :445.53Wedeliatrilolactone A
CAS :Wedeliatrilolactone A is a natural product from Wedelia trilobata.Formule :C23H32O9Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :452.49Prepro-ANF (56-92), human
CAS :Human prepro-ANF (56-92) activates renal guanylate cyclase and boosts its activity.Formule :C173H270N44O57Couleur et forme :SolidMasse moléculaire :3878.26m-PEG11-C2-NHS Ester
m-PEG11-C2-NHS Ester is a PEG-based linker for PROTACs which joins two essential ligands, crucial for forming PROTAC molecules.Formule :C30H55NO16Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :685.76FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Couleur et forme :SolidMasse moléculaire :3692.15NVP-BSK805 2HCl (1092499-93-8(free base))
NVP-BSK805 2HCl (1092499-93-8(free base)) (BSK 805)(IC50=0.5 nM), a specific and effective ATP-competitive JAK2 inhibitor, is more than 20-fold specificity overFormule :C27H28F2N6O·2HClDegré de pureté :99.13%Couleur et forme :SolidMasse moléculaire :563.47Ref: TM-T6294
1mg35,00€5mg99,00€10mg137,00€1mL*10mM (DMSO)215,00€25mg245,00€50mg346,00€100mg495,00€200mg677,00€Axinelline A
CAS :Axinelline A: COX inhibitor, IC50 of 2.22 μM (COX-2) & 8.89 μM (COX-1), anti-inflammatory.Formule :C12H15NO6Couleur et forme :SolidMasse moléculaire :269.25Delphisine (8,14-Diacetylneoline)
Delphisine (8,14-Diacetylneoline) is a useful organic compound for research related to life sciences and the catalog number is T131501.Formule :C28H43NO8Couleur et forme :SolidMasse moléculaire :521.651Compound 0449-0159
Compound 0449-0159 is a useful organic compound for research related to life sciences and the catalog number is T131640.Formule :C20H26N2O2Couleur et forme :SolidMasse moléculaire :326.44Amino-PEG36-Boc
Amino-PEG36-Boc is a PEG-based linker for PROTACs which joins two essential ligands, crucial for forming PROTAC molecules.Formule :C79H159NO38Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1731.09[Nle13]-Motilin
CAS :[Nle13]-Motilin, a motilin analogue, is a motilin receptor agonist [1] [2] .Formule :C121H190N34O35Couleur et forme :SolidMasse moléculaire :2681.01Physalin A
CAS :Physalin A is an anti-inflammatory compound isolated from P. alkekengi with anti-fibrotic effects.Formule :C28H30O10Degré de pureté :99.71%Couleur et forme :SolidMasse moléculaire :526.53FR252384
CAS :FR252384 is an antagonist of the neuropeptide Y-Y5 receptor (IC50: 2.3 nM).Formule :C18H17N3Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :275.35Mahanimbine
CAS :Mahanimbine, an alkaloid from Murraya koenigii roots, leaves, stems, affects pancreatic cells in diabetic rats.Formule :C23H25NODegré de pureté :98%Couleur et forme :SolidMasse moléculaire :331.453,8-Dihydroxy-1-methylanthraquinone-2-carboxylic a
CAS :3,8-Dihydroxy-1-methylanthraquinone-2-carboxylic a is a useful organic compound for research related to life sciences.Formule :C16H10O6Couleur et forme :SolidMasse moléculaire :298.25Distinctin
CAS :Distinctin, an antimicrobial peptide derived from frog skin, exhibits antibacterial activity against a range of pathogens including E.Formule :C131H226N40O35SCouleur et forme :SolidMasse moléculaire :2953.51Fluoroglycofen
CAS :Fluoroglycofen is a herbicide used in vineyards to eradicate weeds.Formule :C16H9ClF3NO7Couleur et forme :SolidMasse moléculaire :419.69Macrocarpal O
CAS :Macrocarpal O is a natural product from Eucalyptus globulus.Formule :C28H40O6Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :472.61ZK-158252
CAS :ZK-158252 is a selective antagonist of BLT1 receptor.
Formule :C29H36O3Couleur et forme :SolidMasse moléculaire :432.592',4'-Dihydroxy-2,3',6'-trimethoxychalcone
CAS :2',4'-Dihydroxy-2,3',6'-trimethoxychalcone is a natural product of Scutellaria, Lamiaceae.Formule :C18H18O6Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :330.33[Nphe1]Nociceptin(1-13)NH2 TFA
[Nphe1]Nociceptin(1-13)NH2 is a selective nociceptin receptor antagonist with potential analgesic properties, pKi=8.4, pA2=6.0.Formule :C63H101F3N22O17Couleur et forme :SolidMasse moléculaire :1495.61PROTAC BRD9-binding moiety 5
CAS :PROTAC BRD9 binder moiety 5 selectively binds BRD9 with IC50 4.20μM, used in PROTAC synthesis, shows cancer cell antiproliferative activity.Formule :C19H18N6OCouleur et forme :SolidMasse moléculaire :346.39Cantabiline sodium
CAS :Cantabiline sodium: a coumarin-based spasmolytic, choleretic, UV-protective agent; used in nitric acid analysis.Formule :C10H7NaO3Couleur et forme :SolidMasse moléculaire :198.15IRL-1620
CAS :IRL-1620 is an effective and selective agonist of endothelin receptor type B (ETB) (Ki: 16 pM).Formule :C86H117N17O27Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1820.97426-Nor-8-oxo-α-onocerin
CAS :26-Nor-8-oxo-alpha-onocerin boosts osteoblast growth; effects vary with time, dose, and cell maturity.Formule :C29H48O3Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :444.69Sutchuenmedin A
CAS :Sutchuenmedin A is a natural product from Epimedium sutchuenense.Formule :C33H38O14Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :658.65Cleomiscosin A
CAS :Cleomiscosin A, from Acer okamotoanum, inhibits mouse TNF-α and may prevent LDL oxidation in atherosclerosis.Formule :C20H18O8Degré de pureté :99.85%Couleur et forme :SolidMasse moléculaire :386.35Sootepin D
CAS :Sootepin D is a triterpene from the apical bud of Gardenia sootepensis, and is TNF-α-induced NF-κB inhibitor(IC50 of 8.3μM),with anti-inflammatory activity.Formule :C31H48O4Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :484.71Fluorescent HIV Substrate
CAS :Fluorescent HIV Substrate is a HIV substrate.Formule :C50H76N14O14Couleur et forme :SolidMasse moléculaire :1097.22Tecastemizole
CAS :Tecastemizole (R 43512) is a selective antagonist of H1 receptor and a major metabolite of astemizole with anti-inflammatory effects.Formule :C19H21FN4Degré de pureté :99.70%Couleur et forme :SolidMasse moléculaire :324.4Ref: TM-T26253
1mg54,00€5mg118,00€1mL*10mM (DMSO)131,00€10mg168,00€25mg288,00€50mg414,00€100mg583,00€500mg1.161,00€
![[Nle13]-Motilin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FT76359.webp&w=3840&q=75)
