Peptides

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Peptide H-YYQQLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-LSLVPDSEQGEAILPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Z-Leu-Leu-Leu-H (aldehyde) is an inhibitor that binds to a receptor and prevents the binding of a ligand. This competitive inhibition is reversible and can be used as a research tool to study protein interactions. The high purity of this product makes it ideal for use in pharmacology, cell biology, and life science research.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Peptide H-LDIDSAPITAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-FAIQDISVEETSAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-GNPTVEVDLFTSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Biot-RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-KAVYNFATM-OMe is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GWNWTSGFNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide LCBiot-MACPGFLWALVISTCLEFSMA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-LVESLPQEIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Boc-Lys(Cl-Z)-OH is a research tool that belongs to the group of peptides. It is an inhibitor of ion channels and can be used as a pharmacological agent. Boc-Lys(Cl-Z)-OH is an agonist of G protein coupled receptors, which are found on cell membranes. It may also be used to activate receptor tyrosine kinases. Boc-Lys(Cl-Z)-OH is a high purity product with &gt; 99% purity.</p>

Peptide H-YNDDDTFTVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Peptide Ac-CVKKDQLGKN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Cyclo(Arg-Gly-Asp-D-Phe-Cys) is a cyclic peptide that can form stable complexes with platinum. It has been shown to have anticancer activity against cervical cancer cells in tissue culture. Cyclo(Arg-Gly-Asp-D-Phe-Cys) binds to the integrin receptor on the surface of cancer cells, which leads to changes in redox potential, leading to cell death by apoptosis or necrosis. Cyclo(Arg-Gly-Asp-D-Phe-Cys) also has pharmacological properties that make it a good candidate for treatment of cancer.</p>

<p>Ac-Leu-Pro-Phe-Phe-Asp-NH2 is a potential therapeutic for Alzheimer's disease. It has been shown to reduce the production of reactive oxygen species and inhibit the formation of amyloid beta oligomers. Ac-Leu-Pro-Phe-Phe-Asp-NH2 also reduces the frequency of protofibrils, which are aggregates that may play a role in Alzheimer's disease pathology. This peptide has been shown to have a protective effect on cell populations, which may lead to therapeutics that can delay or prevent Alzheimer's disease. Ac-Leu-Pro-Phe-Phe-Asp NH2 is an inhibitor of amyloid beta peptides and modulates their aggregation into protofibrils.</p>

Peptide H-IFFYDSENPPASEVLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-VVFDDTYDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide Cyc-Biot-YCWSQYLCY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-E^V^D^P^I^G^HL^Y^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide Lauric Acid-HNKHLPSTQPLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-LVLLNAIYLSAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-THLAPYSDEL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GGMQIFV^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GNLLINIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FESSAAKLKRKYWWK^NLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VMAPRTLL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide PYA-WND-methylamide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Boc-Cys(4-CH3Bzl)-OH is a building block for the synthesis of peptides and other biologically active molecules. It is a protected amino acid that can be used in peptide synthesis, and it is commonly used as a building block for the synthesis of Boc-protected L-amino acids.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Peptide H-YPEAPPSVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>As a chemotactic peptide, For-Met-Leu-Phe (FMLP) has chemotactic properties, which means it can attract cells. For example it is a chemoattractant for phagocytic leukocytes and neutrophils. Neutrophils which have seven transmembrane G-protein coupled receptors are activated during the acute inflammatory response by FMLP and other chemotactic factors which bind to its surface receptors. This results in the activate of NF- κB, MAPK and PI3K pathways. In particular FMLP is known to induce Interleukin-8 (IL-8) which is responsible for both tissue damage and the pathogenesis of inflammatory processes resulting from neutrophils. Chemotactic peptide have been used to study the function of polymorphonuclear leukocytes and other white blood cells in inflammation. Chemotactic peptides are often used as fluorescent probes to measure intracellular metabolic responses to chemoattractant stimulation.<br>This product is available as a 0.5mg vial.</p>

<p>Peptide H-GSLQKRGIV^E-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DIAPTLTLYVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-SLGRKIQI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>H-Ala-Ala-Ala-pNA • HCl is a porcine pancreatic elastase inhibitor. It is a chromogenic substrate that inhibits the proteolytic activity of elastase by binding to the active site and blocking its access to the peptide bond. H-Ala-Ala-Ala-pNA • HCl is used as an enzyme inhibitor in biochemistry and molecular biology research, and has been shown to inhibit enzymatic activity of human leukocyte elastase. The peptide is also a substrate for astacin, which cleaves it at the Cys residue.</p>

<p>Peptide Ac-AKFVAAWTLKAA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Suc-KGFLGK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FATVEVTDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-LSTQNVIDAEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-APYTFGQGTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-GQAEVTQDPAPLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Chymostatin is a protein that inhibits the polymerase chain reaction (PCR) by binding to the DNA polymerase. It has been shown to have a hypoglycemic effect in mice with myocardial infarcts and can also induce apoptosis in inflammatory lesions. Chymostatin binds to intracellular targets, such as cell factor and pro-apoptotic protein, which are involved in energy metabolism and inflammatory lesion. The inhibition of these targets may be due to its chemical biology properties, which include the formation of disulfide bonds and basic proteins. Chymostatin is not active against bacterial cells but can inhibit enzyme activities in mammalian cells.</p>

<p>Peptide H-ALDFAVSEYNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Peptide H-KVLEHVVRV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Fmoc-Pra-OH is a bioconjugate used in Click Chemistry. Click Chemistry is a chemical reaction that joins two components together by forming an amide bond between the carboxyl group of one component and the amino group on the other component. Fmoc-Pra-OH was synthesized by reacting the epidermal growth factor (EGF) with a cyclic peptide containing an acid moiety, which was conjugated to the azide group of an azidopropargyl linker. This bioconjugate has been shown to have proliferative activity in vitro and structural studies have been performed to understand its reactivity.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Peptide H-GDVAFVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-LFGPVDSEQLSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide LCBiot-SSTGSIDMVD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-SL^EDLQL^THNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SDPNFLRF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LAAFPEDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-YNWNSFGLR^Y-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-LPFPIIDDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-YGIDWASGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-KIPNPDFFEDLEPFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-VPNALTDDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NVTGFFQSFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Biot-RKRSRAE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DTYIHWVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-HTLNQIDEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide 5Fam-LTARHKILHRLLQEGSPSD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Biot-KAGFFKRQYKSILQEENRRDSWSYINSKSNDD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Human insulin is a peptide hormone produced by beta cells in the pancreas. The insulin receptor is found on the surface of liver, fat, and muscle cells. When binding to its receptor, insulin opens ion channels allowing potassium ions to flow into the cell and sodium ions to flow out of the cell. This change in ion concentration causes an electrical potential across the membrane that triggers an influx of calcium ions from outside the cell. These changes result in an increase in glucose uptake by tissues and inhibition of glucose production by the liver. Insulin also binds to a secondary receptor called IGF-1R (insulin-like growth factor) which activates intracellular signaling pathways involving PI3K and Akt kinase. Insulin can be used as a research tool for studying protein-protein interactions or as a pharmacological agent for diabetes treatment. <br>This product is enzymatically derived from Porcine Insulin A-chain, available as a 0.5mg vial and contains disulfide bonds between CysA6-CysA11,CysA7-CysB7, and CysA20-CysB19.</p>

<p>Fmoc-Acc-OH is a proteolytic amino acid with an apical profile. It is used as a building block for peptide synthesis and as a tool for the synthesis of peptides, proteins, and other biomolecules. Fmoc-Acc-OH has been shown to induce apoptosis in cancer cells and viruses. This amino acid also has biochemical properties that include reversine-treated apoptotic signaling and anti-inflammatory activities.</p>

<p>Peptide LCBiot-YGRKKRRQRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-LQLQPFPQPQLPYPQPQLPYPQPQLPYPQPQPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide H-LLIYWASTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VPFLVAETPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ILSPFLP^LL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-GSQITQQSTNQSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide H-G^V^Y^D^G^R^E^HT^V^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Aprotinin is a pharmacological agent that inhibits the activity of enzymes such as plasmin, kallikrein, and trypsin. It is used to prevent or reduce the severity of ischemia-reperfusion injury in heart surgery. Aprotinin also inhibits platelet aggregation and promotes blood coagulation. The drug has been shown to inhibit the activity of x-ray crystallographic inhibitor molecules that are involved in intermolecular hydrogen bonding and multivariate logistic regression. Aprotinin has been shown to have effects on eosinophil cationic protein (ECP), which may be related to its anti-inflammatory properties.</p>

<p>Peptide H-DPLSMVGPSQGR^SPSYAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>