CymitQuimica logo
Peptides

Peptides

Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.

Sous-catégories appartenant à la catégorie "Peptides"

29788 produits trouvés pour "Peptides"

Trier par

Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
produits par page.
  • Ac-CY-NH2


    Peptide Ac-CY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43128

    ne
    À demander
  • β-Sheet Breaker Peptide iAß5 (Bulk)

    CAS :
    β-Sheet Breaker Peptide iAß5 (Bulk) is a peptide that inhibits the formation of β-sheets in proteins. It has been shown to be an excellent inhibitor of protein interactions, with good selectivity for its target. This peptide also has high purity and can be used as a research tool for studying the function of ion channels and antibodies.
    Formule :C33H43N5O8
    Degré de pureté :Min. 95%
    Masse moléculaire :637.74 g/mol

    Ref: 3D-PAB-3615-PI

    5mg
    187,00€
    25mg
    624,00€
  • Biotin-dPEG®11-MAL

    CAS :

    Biotin-dPEG®11-MAL is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Biotin-dPEG®11-MAL is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

    Formule :C41H71N5O16S
    Degré de pureté :Min. 95%
    Masse moléculaire :922.09 g/mol

    Ref: 3D-DPG-5871

    25mg
    423,00€
  • H-STTTGHLIYK^-OH


    Peptide H-STTTGHLIYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41495

    ne
    À demander
  • Ac-SIINFEKL-NH2


    Peptide Ac-SIINFEKL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45734

    ne
    À demander
  • Cilengitide

    CAS :
    Cilengitide is a new chemotherapeutic agent that was shown to be effective against renal cell cancer in vitro. Cilengitide inhibits the polymerase chain reaction, arresting the growth of cells. It has minimal toxicity and natural compounds, which make it a promising drug for the treatment of human cancers. Cilengitide binds to integrin receptors on malignant brain cells and inhibits their ability to migrate, inducing apoptosis. This drug also inhibits the production of chemoattractant protein and can be used as an adjuvant therapy for radiation and antibiotic-resistant strains of bacteria.
    Formule :C27H40N8O7
    Degré de pureté :Min. 95%
    Masse moléculaire :588.67 g/mol

    Ref: 3D-RGD-3036-PI

    1mg
    144,00€
    5mg
    461,00€
    25mg
    1.466,00€
  • 1-(Fmoc-Aminomethyl)-Beta-D-Galacturonic Acid

    CAS :
    1-(Fmoc-Aminomethyl)-Beta-D-Galacturonic Acid is a glycopeptide that has been shown to be taken up by the cells of humans. It is also effective when given at doses of 1 mg/kg. This drug can be pegylated, which increases its uptake in humans and prevents it from being degraded in the liver. The pharmacokinetic properties of 1-(Fmoc-Aminomethyl)-Beta-D-Galacturonic Acid have been studied in humans, where it was found that this drug can be detected in plasma as well as in urine after single or multiple doses. The human studies done with this drug have shown that it has a short half life and is quickly eliminated from the body. Positron emission tomography (PET) studies have indicated that this drug may bind to specific receptors on the surface of cells, which could potentially lead to new diagnostic applications for beta-galactosid
    Formule :C22H23NO8
    Degré de pureté :Min. 95 Area-%
    Masse moléculaire :429.42 g/mol

    Ref: 3D-SAA-1928-PI

    1g
    4.239,00€
    100mg
    971,00€
  • [Trp3, Arg5]-Ghrelin (1-5)

    CAS :
    [Trp3, Arg5]-Ghrelin (1-5) is a Growth-Hormone Secretagogue (GHS) receptor agonist which stimulates growth hormone release . The full lenth 28 amino acid peptide Ghrelin is a peptide hormone that regulates appetite, energy balance, meal initiation and nutrient sensing. Ghrelin is produced in the stomach, but is also found in the blood, brain, and other tissues.. It influences bodily functions through associating with growth hormone secretagogue receptors (GHS-R) through its unique N-octanoyl group which is linked to its serine 3 residue covalently. It wider functions are in the regulation of insulin resistance, diabetes and obesity. On top of this Ghrelin is also found to be involved with glucose homeostasis, energy homeostasis, cardio-protective effects, bone metabolism and is a potential target for cancer. Therefore it can be used to develop therapies for a whole spectrum of diseases. This molecule is used as a research tool for studying cell biology and pharmacology.
    Formule :C31H41N9O7
    Degré de pureté :Min. 95%
    Masse moléculaire :651.73 g/mol

    Ref: 3D-PGH-3902-PI

    1mg
    183,00€
    5mg
    604,00€
  • LL-37 ( Human)

    CAS :
    LL-37 is a 37 amino acid peptide that is produced by neutrophils and other leukocytes. This peptide has been shown to have anti-inflammatory properties, which may be due to its ability to bind and activate the G protein coupled receptor (GPCR) formyl peptide receptor-like 1 (FPRL1), leading to inhibition of the production of inflammatory mediators such as IL-8. LL-37 also binds to ion channels, which may lead to membrane depolarization, thereby blocking calcium influx into the cell. LL-37 has been shown to inhibit the activation of T cells by inhibiting T cell receptor signaling and reducing cytokine production. LL-37 also has a high affinity for antibody binding sites on B cells and macrophages and can bind with high specificity to IgE on mast cells, leading to inhibition of mast cell degranulation. The binding of LL-37 with these receptors leads to reduced inflammation in tissues, which may
    Formule :C205H340N60O53
    Degré de pureté :Min. 95%
    Masse moléculaire :4,493.3 g/mol

    Ref: 3D-PLL-4445-S

    100µg
    515,00€
  • H-ETTVFENLPEK^-OH


    Peptide H-ETTVFENLPEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42459

    ne
    À demander
  • Fmoc-Cys(Trt)-OH

    CAS :
    Fmoc-Cys(Trt)-OH is a chemical compound that has been shown to have potent antitumor activity in mice. It is synthesized by the stepwise addition of amino acids to the resin-bound Cys residue in the presence of trifluoroacetic acid and a coupling agent such as EDC. This reaction produces a functional protein with an amide bond. The acetylcholine receptor binding properties of Fmoc-Cys(Trt)-OH are due to its ability to form a disulfide bond with cysteine residues on the receptor.
    Formule :C37H31NO4S
    Degré de pureté :Min. 98.0 Area-%
    Masse moléculaire :585.71 g/mol

    Ref: 3D-FLC-1718-PI

    5g
    153,00€
    25g
    211,00€
    100g
    506,00€
  • Ac-GCRDGPQGIAGQDRCG-OH


    Peptide Ac-GCRDGPQGIAGQDRCG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46251

    ne
    À demander
  • Neuropeptide S (Human)

    CAS :
    Neuropeptide S is a neuropeptide and a novel modulator of arousal and anxiety. This neuropeptide is found in the mammalian brain and is also involved in the suppression of food intake, reward-like effects, mediation of fear expression and memory and learning processes. This product can be used in pharmacological research and is available as a 0.5 mg vial.
    Formule :C93H155N31O28S
    Degré de pureté :Min. 95%
    Masse moléculaire :2,187.5 g/mol

    Ref: 3D-PNP-4425-V

    500µg
    885,00€
  • Dabcyl-Leu-Ala-Gln-Ala-Val-Arg-Ser-Ser-Ser-Arg-Edans

    CAS :
    TNF-a is shed from cell membranes by TNF-a-FW cleaving enzyme (TACE). Incubation of the TACE substrate with recombinant human TACE gives a specific cleavage to restore the quenched fluorescence. The substrate is widely used to screen inhibitors of TNF-α converting enzyme (TACE, ADAM17 endopeptidase) activity. On application is its use as a TACE FRET Substrate I and it is available as a Trifluoroacetate Salt.
    Formule :C70H104N22O18S
    Degré de pureté :Min. 95%
    Masse moléculaire :1,573.81 g/mol

    Ref: 3D-SFQ-3764-PI

    1mg
    452,00€
    5mg
    1.435,00€
  • MOCAc-Lys-Pro-Leu-Gly-Leu-Dap(Dnp)-Ala-Arg-NH2

    CAS :
    MOCAc-Lys-Pro-Leu-Gly-Leu-Dap(Dnp)-Ala-Arg-NH2 is a peptide that has been shown to inhibit the activity of ADAM17. It blocks the cleavage of proMMP1, MMP2, and MMP9 and inhibits collagenase, stromelysin, and cathepsin activities. This peptide may be useful for the prevention and treatment of diseases associated with excessive proteolytic activity such as arthritis or cancer.
    Formule :C55H80N16O16
    Degré de pureté :Min. 95%
    Masse moléculaire :1,221.35 g/mol

    Ref: 3D-SMO-3670-PI

    1mg
    355,00€
    5mg
    646,00€
  • β-Lipotropin (61-69)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Formule :C45H66N10O15S
    Masse moléculaire :1,019.15 g/mol

    Ref: 3D-PP50765

    ne
    À demander
  • Aminomethylated Polystyrene Resin • HCl (200-400 mesh) 1% DVB


    Aminomethylated Polystyrene Resin • HCl (200-400 mesh) 1% DVB is a purified solid resin that has been chemically modified with amine groups. This product can be used as an inhibitor, activator, or ligand in research applications. Aminomethylated Polystyrene Resin • HCl (200-400 mesh) 1% DVB is also useful as a reagent for Protein interactions and Receptor binding studies. It is available in high purity and can be used as a research tool in Cell Biology and Pharmacology experiments.
    Degré de pureté :Min. 95%

    Ref: 3D-RAM-1049-PI

    5g
    141,00€
    25g
    454,00€
  • H-Gly-Pro-Arg-Pro-OH

    Produit contrôlé
    CAS :
    H-Gly-Pro-Arg-Pro-OH is a sealant that has been shown to be effective in the treatment of bowel disease. It is a calcium binding compound that can be administered topically or systemically. H-Gly-Pro-Arg-Pro-OH has clinical relevance in vivo with human beings and exhibits ATP levels that are similar to those found in normal tissue. The surface glycoprotein of this compound has been shown to have an affinity for epidermal growth factor, which may play a role in inflammatory bowel disease. HGPAROH is activated by fibrinogen, which leads to its bound form being recognized by monoclonal antibody as well as the human serum proteins (e.g., albumin).
    Formule :C18H31N7O5
    Degré de pureté :Min. 95%
    Masse moléculaire :425.48 g/mol

    Ref: 3D-INH-3797-PI

    5mg
    136,00€
    25mg
    287,00€
  • Linaclotide

    CAS :
    Linaclotide is a peptide drug that has been shown to be effective in treating chronic constipation. It belongs to the class of pharmacological agents and is used as a treatment for bowel disease, specifically chronic idiopathic constipation. Linaclotide increases the frequency of bowel movements by acting on the ileum and colon. This drug has been shown to be safe for use in pregnant women and children, with no adverse effects observed at doses up to 100 mcg/kg/day. The most common side effect is diarrhea, which can be managed with dietary changes or other medications. Linaclotide has not been found to interact with other drugs, but patients should always consult their doctor before taking any new medication while on linaclotide.
    Formule :C59H79N15O21S6
    Degré de pureté :Min. 95%
    Masse moléculaire :1,526.76 g/mol

    Ref: 3D-LIN-3796-PI

    1mg
    1.022,00€
    5mg
    3.977,00€
  • Poly-L-Lysine Hydrobromide

    CAS :

    Poly-L-Lysine Hydrobromide is a neurotrophic factor that is used to stimulate nerve growth in the peripheral nervous system. It has been shown to increase the production of nerve growth factor, which is important for neuronal development and regeneration. Poly-L-Lysine Hydrobromide also has biological properties against human erythrocytes, enabling it to bind to the erythrocyte membrane and subsequently cause hemolysis. This process is mediated by Toll-like receptors. The active form of this drug has been shown to have antiviral activity against HIV and other viruses in transfection experiments using cells from mice, as well as an ability to inhibit replication of herpes simplex virus type 1 (HSV-1) in a model system consisting of rat neurons grown on a polymer substrate. Poly-L-Lysine Hydrobromide can be cleaved into smaller pieces by enzymes such as DNase I or terminal transferases, forming polymers

    Degré de pureté :Min. 95%

    Ref: 3D-OKK-3056

    1g
    471,00€
    100mg
    211,00€
  • Abz-Ala-Gly-Leu-Ala-p-Nitro-Benzyl-Amide

    CAS :

    Abz-Ala-Gly-Leu-Ala-p-Nitro-Benzyl-Amide is an enzyme inhibitor that is used to treat cancer. It is a potent and selective inhibitor of neutral endopeptidase, which is an enzyme involved in the process of inflammation. Abz-Ala-Gly-Leu-Ala-p-Nitro-Benzyl Amide can be used to inhibit the interaction between gram negative bacteria and human cells, and has been shown to have antimicrobial properties against Pseudomonas aeruginosa. This compound may also be able to modulate metalloendopeptidases, which are resistant to endopeptidases.

    Formule :C28H37N7O7
    Degré de pureté :Min. 95%
    Masse moléculaire :583.64 g/mol

    Ref: 3D-SAG-3905-PI

    5mg
    136,00€
    25mg
    363,00€
  • H-LLAEELPLR^-OH


    Peptide H-LLAEELPLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41901

    ne
    À demander
  • Biot-XXXXXX-OH


    Peptide Biot-XXXXXX-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46593

    ne
    À demander
  • H-YPDAVATWLNPDPSQK^-OH


    Peptide H-YPDAVATWLNPDPSQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45649

    ne
    À demander
  • H-Lys-Thr-Glu-Glu-Ile-Ser-Glu-Val-Lys-Met-pNA


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Formule :C56H92N14O20S
    Masse moléculaire :1,313.5 g/mol

    Ref: 3D-PP50786

    ne
    À demander
  • p-Methyl-Benzhydrylamine Resin•HCl (200-400 mesh) 1% DVB


    MBHA resin is a solid phase synthesis material that is used as a building block in the synthesis of peptides. The resin is a very stable, insoluble polymer with a high capacity for binding amino acids. MBHA resin provides a clean surface for peptide synthesis and an efficient coupling reaction. It can be used to make any type of peptide, including natural and unnatural amino acids and modified amino acids.
    Degré de pureté :Min. 95%

    Ref: 3D-RMB-2100-PI

    5g
    136,00€
    25g
    392,00€
    100g
    953,00€
  • Fmoc-D-Pro-OH

    CAS :

    Fmoc-D-Pro-OH is a building block for peptide synthesis. It is a protected form of proline with an amido group, which can be used to synthesize polypeptides. Fmoc-D-Pro-OH can be coupled with other amino acids using the aldol condensation or methodologies like the strategy of organocatalysts. This building block is also useful in the synthesis of macrocycles and cyclohexanones, which are aliphatic and cyclic compounds. The recoverable nature of Fmoc-D-Pro-OH allows it to be reused in multiple reactions, so it is an economical choice for Building Blocks.

    Formule :C20H19NO4
    Degré de pureté :Min. 95%
    Masse moléculaire :337.38 g/mol

    Ref: 3D-FDP-1826-PI

    1g
    136,00€
    5g
    288,00€
  • Big Endothelin-1 (Porcine, 1-39)

    CAS :
    This product has disulfide Bonds between Cys1-Cys15 and Cys3-Cys11, is sourced from: Porcine, 1-39 and is available as a 0.1mg vial. Big Endothelin-1 (Porcine, 1-39) is a precursor peptide of the vasoconstrictor Endothelin-1 (ET-1). ET-1 exhibits vasoconstrictive properties and is an activator of endothelin G-protein coupled receptors. Furthermore ET-1 is produced when inflammation, vascular stress or hypoxia occurs. In vivo Big Endothelin-1 has a greater half life compared to ET-1 and therefore makes it useful to study secretory activity in the endothelial system. Overall Big Endothelin-1 (Porcine, 1-39) can be used as a research tool for studying protein interactions, receptor activation and function, and ligand binding. This peptide is also used in pharmacology to study the effects of therapeutic agents on receptor activity and expression.
    Formule :C193H289N49O58S5
    Degré de pureté :Min. 95%
    Masse moléculaire :4,384 g/mol

    Ref: 3D-PED-4207-S

    100µg
    870,00€
  • LCBiot-AYEQNPQHFIEDLEK-OH


    Peptide LCBiot-AYEQNPQHFIEDLEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44010

    ne
    À demander
  • H-VLGAFSDGLAHLDNLK^-OH


    Peptide H-VLGAFSDGLAHLDNLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46500

    ne
    À demander
  • Biotinyl-Asp-Glu-Val-Asp-H (aldehyde)

    CAS :
    Biotinyl-Asp-Glu-Val-Asp-H (aldehyde) is a peptide that has been used as a research tool for the study of ion channels and protein interactions. It has an affinity for the receptor site on cell membranes, which may be due to its ability to act as an inhibitor or ligand. This peptide has been shown to bind to the acetylcholine receptor, which is involved in neurotransmission and nerve function. Biotinyl-Asp-Glu-Val-Asp-H (aldehyde) binds with high specificity to the receptor site and blocks the binding of acetylcholine, inhibiting nerve transmission.
    Formule :C28H42N6O12S
    Degré de pureté :Min. 95%
    Masse moléculaire :686.73 g/mol

    Ref: 3D-IBA-3173-V

    1mg
    479,00€
  • H-CSIHRILQRMCERAEGTVGV-NH2


    Peptide H-CSIHRILQRMCERAEGTVGV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49642

    ne
    À demander
  • Influenza NP (147-155)

    CAS :

    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Formule :C48H82N16O14
    Masse moléculaire :1,107.29 g/mol

    Ref: 3D-PP50036

    ne
    À demander
  • H-SYL^DSGIHF-OH


    Peptide H-SYL^DSGIHF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42399

    ne
    À demander
  • H-VEWLR^-OH


    Peptide H-VEWLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42465

    ne
    À demander
  • Dabcyl-γ-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-Edans

    Produit contrôlé
    CAS :
    Dabcyl-γ-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-Edans is an angiotensinogen peptide. It has been used as a substrate for Renin and assayed by fluorescence to study the binding affinity of protease inhibitors. Dabcyl is a fluorescent label that can be used in peptide and biochemicals assays, including fluorescence assay. Dabcyl is soluble in water and has little fluorescence quenching with other compounds, making it ideal for use in these applications.
    Formule :C90H120N22O16S
    Degré de pureté :Min. 95%
    Masse moléculaire :1,798.16 g/mol

    Ref: 3D-SFQ-3731-PI

    1mg
    624,00€
    5mg
    2.165,00€
  • Insulin (Human)

    CAS :

    Insulin is a peptide hormone that regulates the uptake and storage of glucose by muscle and fat cells. Insulin is produced by beta cells in the pancreas, which release it into the bloodstream when blood sugar levels rise. Insulin lowers glucose levels by increasing the amount of glucose taken up from the blood into muscle and fat cells, suppressing hepatic gluconeogenesis, and promoting glycolysis. It also increases protein synthesis, decreases proteolysis, and stimulates growth. With a molecular weight of 5808 Da, insulin is composed of two polypeptide chains with an approximate molecular weight of 3120 Da each linked by disulfide bonds. Insulin has no lipid moiety or carbohydrate moiety.
    Insulin binds to its receptor on the surface of a cell to trigger one or more signaling cascades leading to changes in metabolism. Binding to the receptor triggers a conformational change in the receptor that causes insulin to be released from its binding site on the receptor.

    Formule :C257H383N65O77S6
    Degré de pureté :Min. 95%
    Masse moléculaire :5,807.6 g/mol

    Ref: 3D-PIN-4088-S

    100µg
    657,00€
  • H-IQNILTEEPK^-OH


    Peptide H-IQNILTEEPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45863

    ne
    À demander
  • Galactosyl-Cyclo(Arg-Gly-Asp-D-Phe-Lys)

    CAS :

    Galactosyl-Cyclo(Arg-Gly-Asp-D-Phe-Lys) is a monoclonal antibody that binds to the integrin receptor, which is involved in the proliferation and migration of cells. It has been shown to be an effective treatment for prostate cancer cells in vitro. Galactosyl-Cyclo(Arg-Gly-Asp-D-Phe-Lys) also shows potential as a biomarker for atherosclerotic lesions. The drug has been shown to have pharmacokinetic properties in humans and can inhibit epidermal growth factor (EGF) activity.

    Formule :C34H52N10O12
    Degré de pureté :Min. 95%
    Masse moléculaire :792.85 g/mol

    Ref: 3D-RGD-3736-PI

    1mg
    689,00€
    5mg
    2.387,00€
  • H-FALLGDFFR^-OH


    Peptide H-FALLGDFFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42503

    ne
    À demander
  • H-SGRGKGGKGLGKGGAKRHRKVLRD-NH2


    Peptide H-SGRGKGGKGLGKGGAKRHRKVLRD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49210

    ne
    À demander
  • H-SLLQHLIGL^-OH


    Peptide H-SLLQHLIGL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47168

    ne
    À demander
  • H-VLEAELL^VLR^-OH


    Peptide H-VLEAELL^VLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49437

    ne
    À demander
  • H-Ser-Phe-Leu-Leu-Arg-Asn-Pro-OH

    CAS :
    H-Ser-Phe-Leu-Leu-Arg-Asn-Pro-OH is a biocompatible polymer that has significant cytotoxicity. It is a pharmacological treatment for infectious diseases, cancer, and brain functions. This polymer has been shown to be effective in the experimental model of atherosclerosis and also induces neuronal death in the low dose group. H-Ser-Phe-Leu-Leu-Arg-Asn Pro OH is a signal peptide that is involved in physiological effects such as cell proliferation, apoptosis, and angiogenesis.
    Formule :C39H63N11O10
    Degré de pureté :Min. 95%
    Masse moléculaire :845.99 g/mol

    Ref: 3D-PAR-3945-PI

    1mg
    141,00€
    5mg
    454,00€
  • HCTU Reagent

    CAS :
    HCTU Reagent is an organic compound that is used for diagnosis of infectious diseases, chemical biology, and polymerase chain reaction. It is a disulfide bond-forming reagent that contains two reactive thiols and can be used to form a disulfide bond between two cysteine residues. HCTU Reagent has been shown to be effective in the treatment of prostate cancer cells by inhibiting the growth factor-β1 receptor and preventing the binding of heme to its intracellular site. This reagent also binds to iron and has conformational properties that are important for cyclic lipopeptides.
    Formule :C11H15N5OClPF6
    Degré de pureté :Min. 98.0 Area-%
    Masse moléculaire :413.69 g/mol

    Ref: 3D-KHC-1018-PI

    5g
    136,00€
    25g
    183,00€
    100g
    337,00€
  • Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat)

    CAS :
    Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat) is an inhibitor of gastric acid secretion and pancreatic enzyme secretion and has been shown to reduce food intake and increase energy expenditure in humans. This product is available in the trifluoroacetate salt form. One letter code: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
    Formule :C192H295N61O60S
    Degré de pureté :Min. 95%
    Masse moléculaire :4,449.93 g/mol

    Ref: 3D-PGL-3826-PI

    1mg
    1.041,00€
    5mg
    3.818,00€
  • Fmoc-11-aminoundecanoic acid

    CAS :

    Fmoc-11-Aminoundecanoic Acid is a molecular modeling reagent that interacts with other elements to form Building Blocks. Fmoc-11-Aminoundecanoic Acid has been shown to have cancer interacting properties, elucidating the molecular interactions of peptides and proteins. It has been used in research as an active analog for growth factors. Fmoc-11-Aminoundecanoic Acid interacts with other molecules, including peptides and proteins, by proteolysis to produce new molecules. The chemical structure of this molecule can be altered through reactions with other molecules such as amino acids or nucleotides.

    Formule :C26H33NO4
    Degré de pureté :Min. 98.0 Area-%
    Masse moléculaire :423.56 g/mol

    Ref: 3D-FAA-1707-PI

    1g
    182,00€
    5g
    521,00€
    25g
    1.856,00€
  • Fmoc-D-His(Trt)-OH

    CAS :
    Fmoc-D-His(Trt)-OH is a chiral building block that is used in peptide synthesis. It can be used to synthesize an enantiomer or homologue of the original amino acid. Fmoc-D-His(Trt)-OH has been postulated to exist as two stereoisomers, 1R,2S and 2R,1S. The 1R,2S enantiomer is the naturally occurring form of this compound and is produced with a shift of +6 ppm in the proton NMR spectrum. The 2R,1S enantiomer has also been observed in the solid state but not in solution and it exhibits a shift of -6 ppm in the proton NMR spectrum. Fmoc-D-His(Trt)-OH is soluble in solvents such as DMSO and DMF. It has also been shown to be a potent inhibitor of organophosphate and re
    Formule :C40H33N3O4
    Degré de pureté :Min. 95%
    Masse moléculaire :619.73 g/mol

    Ref: 3D-FDH-1812-PI

    1g
    136,00€
    5g
    399,00€
  • Tertiapin Q

    CAS :

    Tertiapin Q is a peptide inhibitor, a derivative of tertiapin, from honeybee venom (specifically Apis mellifera). This peptide acts by specifically blocking certain potassium channels, namely Kir1.1 and Kir3.1/3.4. The mode of action involves binding to the outer mouth of the potassium channel pore, effectively inhibiting ion flow through these channels. Tertiapin Q varies from native tertiapin by one amino acid, where a methionine residue is replaced with a glutamine residue. This means that unlike native TPN, TPN(Q) is not air oxidizable.Tertiapin    : H-Ala-Leu-Cys-Asn-Cys-Asn-Arg-Ile-Ile-Ile-Pro-His-Met-Cys-Trp-Lys-Lys-Cys-Gly-Lys-Lys-NH2Tertiapin Q: H-Ala-Leu-Cys-Asn-Cys-Asn-Arg-Ile-Ile-Ile-Pro-His-Gln-Cys-Trp-Lys-Lys-Cys-Gly-Lys-Lys-NH2Tertiapin Q is used in electrophysiological research to study the role and regulation of inward-rectifier potassium channels in various physiological and pathological processes. Its specificity and potency make it an invaluable tool in the exploration of renal physiology and cardiac cellular activity, as well as in neuroscience research for understanding neuronal excitability.

    Formule :C106H175N35O24S4
    Degré de pureté :Min. 95%
    Masse moléculaire :2,452.05 g/mol

    Ref: 3D-TER-3833-PI

    1mg
    1.041,00€
    5mg
    3.818,00€
  • TBTU Reagent

    CAS :
    TBTU Reagent is a combination of two reagents that are used for peptide synthesis and purification. TBTU is an amide coupling reagent that reacts with the carboxyl group of an ester to form a reactive intermediate, which then reacts with the amino group of an amide. This reaction forms an amide bond between the carboxyl group of the ester and the amino group of the amide. TBTU Reagent has been used in vitro assays to measure pharmacological activities such as anti-inflammatory effects and antimicrobial effects. TBTU Reagent has also been used to prepare mouse monoclonal antibodies against toll-like receptor 4 (TLR4).
    Formule :C11H16N5OBF4
    Degré de pureté :Min. 95%
    Masse moléculaire :321.08 g/mol

    Ref: 3D-KTB-1066-PI

    5g
    136,00€
    25g
    211,00€
    100g
    403,00€
  • 2-Furoyl-LIGRLO-amide acetate salt

    CAS :
    2-Furoyl-Leu-Ile-Gly-Arg-Leu-Orn-NH2 is a synthetic peptide that binds to the 5HT3 receptor. It has been shown to have an effect on locomotor activity and growth factor secretion in wild type mice and cell culture, as well as binding to acetylcholine receptors in C57/BL6 mice. 2-Furoyl-Leu-Ile-Gly-Arg-Leu-Orn was synthesized by the reaction of furoic acid with L -alanine, L -glycine, L -arginine and L -ornithine. The product is a white powder.
    Formule :C36H63N11O8
    Degré de pureté :Min. 95%
    Masse moléculaire :777.96 g/mol

    Ref: 3D-PAR-3663-PI

    1mg
    196,00€
    5mg
    445,00€
  • Ac-Pro-Leu-Gly-(2-Mercapto-4-Methylpentanoyl)-Leu-Gly-OEt

    CAS :
    Ac-Pro-Leu-Gly-(2-Mercapto-4-Methylpentanoyl)-Leu-Gly-OEt is a peptide that has been shown to have anti-cancer, enzyme inhibitory, and anti-inflammatory activities. The peptide is derived from the proteolytic cleavage of human collagenase. It inhibits both matrix metalloproteinases (MMPs) and stromelysin in vitro. Acetyl Proleu Gly Gly Leu Gly OEt has also been shown to inhibit cancer cells in culture by inhibiting RNA synthesis and protein synthesis.
    Formule :C31H53N5O8S
    Degré de pureté :Min. 95%
    Masse moléculaire :655.86 g/mol

    Ref: 3D-MMP-3060-PI

    1mg
    157,00€
    5mg
    500,00€
    25mg
    1.191,00€
  • Fibronectin Active Fragment (RGDS)

    CAS :
    Fibronectin is an extracellular matrix protein that plays a critical role in cell adhesion, migration, and differentiation. Fibronectin subunits are composed of repeating units of three types of modules: type I, type II, and type III. The active fragment of fibronectin refers to a small peptide sequence within the type III modules of fibronectin that has been shown to have potent biological activity. The fibronectin active fragment, also known as the cell-binding domain or RGD domain, is a short peptide sequence consisting of the amino acid sequence Arg-Gly-Asp (RGD). This peptide sequence interacts with cell surface receptors known as integrins, which are important for mediating cell adhesion, migration, and signaling. The fibronectin active fragment has been extensively studied as a research tool to investigate the mechanisms of cell adhesion and migration. It has also been used in tissue engineering applications to promote cell attachment and proliferation on synthetic biomaterials. This product is available as a 0.5mg vial.
    Formule :C15H27N7O8
    Degré de pureté :Min. 95%
    Masse moléculaire :433.42 g/mol

    Ref: 3D-PFA-4171-V

    500µg
    182,00€
  • Aminomethylated Polystyrene Resin • HCl (100-200 mesh) 1% DVB


    Aminomethylated Polystyrene Resin • HCl is a resin that is used in peptide synthesis. It is insoluble in water and soluble in organic solvents, such as dichloromethane, chloroform, and dimethylformamide. Aminomethylated Polystyrene Resin • HCl is an unsubstituted resin for solid phase synthesis.
    Degré de pureté :Min. 95%

    Ref: 3D-RAM-1051-PI

    5g
    250,00€
    25g
    753,00€
  • Fmoc-Lys(Boc)-OH

    CAS :
    Fmoc-Lys(Boc)-OH is a monoclonal antibody that reacts with lysine residues. It is synthesized by reacting a solid phase support with an aliphatic hydrocarbon. The reactive functional group on the hydrocarbon terminates in an amine and forms an amide linkage to the amino terminus of the peptide. The hydroxyl terminus of the peptide is then reacted with a trifluoroacetic acid (TFA) ester of lysine in the presence of base. This reaction produces a TFA salt of Fmoc-Lys(Boc)-OH, which can be purified by high salt precipitation or reversed to produce Fmoc-Lys(Boc)-OH by treatment with base. Fmoc-Lys(Boc)-OH has been used as a reagent for chemical conjugation to fluorophores and other molecules such as biotin, avidin, strept
    Formule :C26H32N2O6
    Degré de pureté :Min. 98.0 Area-%
    Masse moléculaire :468.54 g/mol

    Ref: 3D-FLK-1726-PI

    5g
    136,00€
    25g
    242,00€
    100g
    642,00€
  • Boc-D-Met-OH

    CAS :
    Boc-D-Met-OH is an amino acid building block that is used in the synthesis of peptides. It has been shown to have photophysical properties and specificities, as well as a helical structure. Boc-D-Met-OH has also been shown to react with anions, making it useful for peptide synthesis.
    Formule :C10H19NO4S
    Degré de pureté :Min. 95%
    Masse moléculaire :249.33 g/mol

    Ref: 3D-BDM-2608

    1g
    182,00€
    5g
    255,00€
    25g
    745,00€
  • Abz-Thr-Asn-Met-Lys-His-Met-Ala-Gly-Ala-Ala-Gln-EDDnp

    CAS :
    Abz-Thr-Asn-Met-Lys-His-Met-Ala-Gly-Ala-Ala-Gln (EDDNP) is a novel and potent inhibitor of the polymerase chain reaction (PCR). It has been shown to inhibit the activity of DNA polymerases, which are key enzymes in DNA replication. EDDNP binds to the active site of the enzyme and blocks access to the DNA template. In addition, this compound inhibits mitochondrial membrane potential, as well as transcriptional regulation and detoxification enzymes. This compound has also been shown to be effective in vivo in mouse models.
    Formule :C61H91N21O19S2
    Degré de pureté :Min. 95%
    Masse moléculaire :1,486.66 g/mol

    Ref: 3D-SFQ-3916-PI

    1mg
    196,00€
    5mg
    523,00€
  • CA-074 Me

    CAS :
    CA-074 Me is a small molecule that binds to the receptor site of the ion channel. This binding triggers a conformational change in the ion channel, which leads to an influx of ions and an increase in membrane potential. CA-074 Me has also been shown to bind to peptide receptors and activate them, leading to similar effects on cell membranes as with ion channels. CA-074 Me is used for research purposes as it can be used as a tool for studying protein interactions and ligand-receptor binding. It is also often used as an antibody capture reagent. CA-074 Me is a research chemical that was synthesized by Hetero Drugs Limited (India) and has CAS No. 147859-80-1.END>
    Formule :C19H31N3O6
    Degré de pureté :Min. 95%
    Masse moléculaire :397.47 g/mol

    Ref: 3D-IEC-4323-V

    5mg
    625,00€
  • Oxyma Pure®

    CAS :
    OxymaPure® is a hydrogen bond-based molecular probe that binds to the hydroxamic acid group of bacterial cell walls. It has been shown to have an antibacterial activity against Staphylococcus aureus and Escherichia coli. OxymaPure® is soluble in water, making it suitable for oral administration. The safety profile of OxymaPure® includes studies in rats, indicating that it does not cause any toxic effects at doses up to 2000 mg/kg body weight. OxymaPure® can be synthesized on a solid phase by using carbodiimides as reactive agents and linkers as additive materials. This process is relatively rapid and produces high yields of the desired product.
    Formule :C5H6N2O3
    Degré de pureté :Min. 95%
    Masse moléculaire :142.12 g/mol

    Ref: 3D-OXY-1050-PI

    25g
    135,00€
    100g
    210,00€
  • [Arg8]-Vasopressin (Human, Bovine, Ovine, Rat, Mouse) (0.5 mg vial)

    CAS :
    Vasopressin is a hormone that is synthesized by the hypothalamus and secreted by the pituitary gland. Vasopressin is used in research to activate cells and study receptor-ligand interactions. It can be used to study ion channels, cell biology, and pharmacology. Vasopressin can be used as an inhibitor of peptides or proteins.
    Formule :C46H65N15O12S2
    Degré de pureté :Min. 95%
    Masse moléculaire :1,084.2 g/mol

    Ref: 3D-PVP-4085-V

    500µg
    269,00€
  • Cys-TAT(48-60)


    Peptide derived from the HIV transactivator of transcription protein. TAT is a cationic cell-penetrating peptide.

    Degré de pureté :Min. 95%
    Couleur et forme :Powder
    Masse moléculaire :1,821.18 g/mol

    Ref: 3D-CRB1000341

    1mg
    282,00€
    500µg
    206,00€
  • Cathepsin G FRET substrate [5-FAM]/[6-TAMRA]


    Substrate peptide for Cathepsin G, a serine protease belonging to the chymotrypsin superfamily which acts as a physiologic regulator of platelet activation and thrombus formation. Cathepsin G also has antimicrobial activity and is involved in chemotaxis, apoptosis, the immune response and inflammation and hydrolysis of extracellular matrix proteins. Cathepsin G can cleave protease activated receptor-4 (PAR4) and is a potential target for novel anti-thrombotic therapies.This peptide contains the FRET pair: 5-Carboxyfluorescein (5-FAM) and 6-Carboxytetramethylrhodamine (6-TAMRA). 5-Carboxyfluorescein (5-FAM), which is present at the N-terminus of this peptide, is a widely used green fluorescent tag which excites at 495 nm and emits at 517 nm. 6-carboxytetramethylrhodamine (6-TAMRA), which is attached at the C-terminus, is a widely used fluorescent dye which excites at 546 nm and emits at 579 nm. In the intact peptide 6-TAMRA acts as a quencher of the fluorescence of 5-FAM therefore no fluorescence can be detected. However hydrolysis of the peptide between the donor/acceptor pair allows the fluorescence of 5-FAM to be recovered, enabling the quantitative measurement of enzymatic activity.Fluorescence Resonance Energy Transfer (FRET) peptides are convenient tools for the study of peptidase specificity and enzymatic activity.
    Degré de pureté :Min. 95%
    Couleur et forme :Powder
    Masse moléculaire :1,846.7 g/mol

    Ref: 3D-CRB1100420

    1mg
    543,00€
    100µg
    346,00€
    500µg
    386,00€
  • Click (KFF)3K


    (KFF)3K is a cationic cell penetrating peptide which can be conjugated to PNA oligomers to aid in their penetration of the bacterial cell wall to function as anti-microbials. (KFF)3K is labelled at the N-terminus with an alkyne attachment for ease of reaction with an opposite Click reactive partner (azide).

    Degré de pureté :Min. 95%
    Couleur et forme :Powder
    Masse moléculaire :1,491.8 g/mol

    Ref: 3D-CRB1000125

    1mg
    282,00€
    500µg
    206,00€
  • Histone H3 (1-20) K4Me3, K9Ac, pS10-GG-[Cys(AZ647)]


    Histone H3 (1 - 20) K4Me3 is derived from Histone 3 (H3), which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Like the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing many lysine and arginine residues, they have a positive net charge which interacts electrostatically with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone-modifying enzymes which target histone proteins. Both processes alter the positioning of the nucleosome, allowing the DNA to be either available or inaccessible to the transcription machinery.Histone tails can undergo multiple modifications, including acetylation, methylation, ubiquitylation and sumoylation.  The purpose of the modifications is believed to alter chromatin function/structure.  Lysine 4 of Histone H3 (1 - 20) K4Me3 has been tri-methylated, lysine 9 has been acetylated, and serine 10 has been phosphorylated. This peptide is labelled with the Aurora Fluor 647 fluorescent tag.

    Degré de pureté :Min. 95%
    Masse moléculaire :3,543.6 g/mol

    Ref: 3D-CRB1101681

    100µg
    470,00€
    500µg
    543,00€
  • Alpha-Factor

    CAS :
    The alpha factor pheromone arrests yeast in the G1 phase of their cell cycle, this allows the opposite mating type cells to synchronise. Alpha factor mating pheromone induces the expression of mating genes, changes in nuclear architecture, and polarizes growth toward the mating partner. STE2 encodes the alpha factor pheromone transmembrane G-protein coupled receptor (GPCR) found on mating-type-A cells in yeast. Alpha factor binds Ste2 and activates prototypic mitogen-activated protein kinase (MAPK) cascade. The dose of pheromone exposure differentially activates the MAPK Fus3 for alternate effects. A high dose of alpha factor leads to growth arrest and schmooing formation for mating, a lower dose causes elongated cell growth.
    Formule :C82H114N20O17S
    Degré de pureté :Min. 95%
    Couleur et forme :Powder
    Masse moléculaire :1,683.97 g/mol

    Ref: 3D-CRB1000148

    1mg
    282,00€
    5mg
    543,00€
    10mg
    891,00€
    25mg
    1.028,00€
  • H-PVSKMRMATPLLMQA-OH


    Peptide H-PVSKMRMATPLLMQA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Formule :C72H12N20O19S3
    Masse moléculaire :1,674.1 g/mol

    Ref: 3D-PP45916

    1mg
    322,00€
    10mg
    362,00€
    100mg
    657,00€
  • AAA-C(AF647) C-Terminal Sortagging


    This C-terminal Sortagging peptide acts as a (oligo)glycine nucleophile in the final steps of a sortagging protein labelling reaction. This reaction results in the (AF647) fluorescent moiety being attached to the C-terminus of the target protein or peptide.Sortase A (SrtA) from Staphylococcus aureus has become a valuable tool via sortase-mediated ligation of various substrates for bioconjugation. SrtA recognises the LPxTG motif as a substrate. Cleavage results in a thioester intermediate between the peptide and SrtA. The thioester is resolved by the N-terminus of a nucleophile, usually with two glycines at the start, creating a new bond. In bacteria, SrtA aids surface proteins being ligated into the peptidoglycan cross-bridge. The peptidoglycan of S. pyogenes provides an N-terminal alanine residue for the ligation reaction. AAA-C(AF647) is a nucleophile for SrtA S. pyogenes- the sortase-mediated ligation reaction results in protein labelling with a C-terminal Alexa Fluor 647 fluorescent dye. Alexa Fluor 647 has a maximum emission of 668 nm when excited at 650nm. AAA-C(AF647) has the potential to be used for a wide variety of purposes, as has been demonstrated with other SrtA ligations such as intracellular ligation of protein in living cells.
    Degré de pureté :Min. 95%
    Couleur et forme :Powder
    Masse moléculaire :1,327.4 g/mol

    Ref: 3D-CRB1110654

    100µg
    386,00€
    500µg
    470,00€
  • Pip6a


    Pip6a is part of a novel series of transduction peptides termed Pips (PNA/PMO internalisation peptides). Pip peptides were designed around an original R6-penetratin cell penetrating peptide (CPP) and are able to transport PNA/PMO molecules across cell membranes. Pip peptides can be covalently conjugated to PNAs/PMOs to deliver them to a variety of adult tissues, including liver, kidney, skeletal muscle, diaphragm, and heart.Due to its ability to target the heart, pip6a has important implications for the development of therapeutic antisense oligonucleotide therapy using PMOs for diseases such as Duchenne muscular dystrophy (DMD). DMD causes progressive muscle weakening and often results in cardiac failure and death. Pip6a has also been studied for delivery of antisense oligonucleotide therapy in spinal muscular atrophy (SMA).

    Degré de pureté :Min. 95%
    Couleur et forme :Powder
    Masse moléculaire :2,952.6 g/mol

    Ref: 3D-CRB1000352

    1mg
    282,00€
    20mg
    2.149,00€
    500µg
    206,00€
  • PKA Substrate


    Substrate peptide for adenosine 3',5'-monophosphate (cyclic AMP)-dependent protein kinase (PKA) and related kinases, for use in kinase assays. The peptide sequence is based on the cAMP-dependent protein kinase inhibitor alpha (amino acid 15-23).Protein kinase A (PKA) also known as cAMP-dependent protein kinase is a family of serine/threonine protein kinase enzymes whose activity is regulated by cyclic AMP (cAMP). PKA is involved in a plethora of roles within the cell including: regulation of glycogen, sugar and lipid metabolism and roles within adipocytes and hepatocytes, nucleus accumbens neurons, skeletal muscle, cardiac muscle and in memory formation.
    Degré de pureté :Min. 95%
    Couleur et forme :Powder
    Masse moléculaire :1,117.6 g/mol

    Ref: 3D-CRB1001587

    1mg
    282,00€
    500µg
    206,00€
  • HLA-DRB1*1501 peptide


    The HLA-DRB1*1501 peptide, is encoded by the disease-associated MHC allele histocompatibility leukocyte antigen (HLA)-DRB1*1501 which is present on the MHC region of chromosome 6. The increased frequency of the HLA-DRB*11501 haplotype found in Multiple Sclerosis (MS) patients, may contribute to the MS phenotype through disrupting T cell repertoire selection and through the presentation of self-peptides which can be targeted by the body's autoimmune response. Moreover studies investigating the accumulation of amyloid β-peptide (Aβ) as a factor producing Alzheimer's disease (AD) pathogenicity, found that HLA-DR alleles such as DRB1*1501 demonstrate immunogenic properties. It is evident that the DRB1*1501 halotype is associated with strong Aβ-T cell responses resulting in the large production of IFN- γ and IL-17. Therefore the HLA-DRB1*1501 peptide would be beneficial in studies exploring the phenotypes of autoimmune-diseases like MS and AD.
    Degré de pureté :Min. 95%
    Couleur et forme :Powder
    Masse moléculaire :1,568.7 g/mol

    Ref: 3D-CRB1000570

    1mg
    282,00€
    500µg
    206,00€
  • C-terminal Sortagging-[Cys(AF680)] acid


    This C-terminal Sortagging peptide acts as an (oligo)glycine nucleophile in the final steps of a sortagging protein labelling reaction. This reaction results in the [Cys(AF680)]- fluorescent moiety being attached to the C-terminus of the target protein or peptide.A substrate peptide containing the LPXTG motif is recognised and cleaved by the enzyme Sortase A (SrtA) from Staphylococcus aureus. The catalytic cysteine residue in the active site of SrtA serves as a nucleophile to cleave the peptide bond between threonine and glycine of the substrate peptide. Cleavage results in the formation of a thioacyl intermediate between the substrate peptide and SrtA. This intermediate is then resolved by the N-terminus of this (oligo)glycine nucleophile peptide, resulting in the creation of a new peptide bond that links the substrate peptide to this peptide and its fluorescent dye.  This method of protein labelling is known as sortagging.C-Terminal Sortagging-[Cys(AF680)] contains the AF680 fluorescent dye- AF680 is a bright green dye with excitation at 633 nm, well suited for flow cytometry and imagery. AF680 is particularly photostable, allowing better detection of low abundance conjugates.  C-Terminal Sortagging-[Cys(AF680)] acid is provided here. However, the amide version is also available.
    Degré de pureté :Min. 95%
    Masse moléculaire :1,241.3 g/mol

    Ref: 3D-CRB1101684

    100µg
    386,00€
    500µg
    470,00€
  • H-ADQDTIR^-OH


    Peptide H-ADQDTIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48748

    ne
    À demander
  • MOG (35-55) acid Mouse, Rat

    CAS :
    Myelin oligodendrocyte glycoprotein (MOG) is a member of the immunoglobulin (Ig) protein superfamily and is expressed exclusively in the central nervous system on the surface of myelin sheaths and oligodendrocyte processes. MOG is expressed at the onset of myelination, and therefore is a potential marker for oligodendrocyte maturation.MOG contains an extracellular domain, a transmembrane domain, a cytoplasmic loop, a membrane-associated region and a cytoplasmic tail.  MOG may function as a cell surface receptor or cell adhesion molecule.  Fifteen different alternatively spliced isoforms have been detected in humans. These are present either on the cell surface, the endoplasmic reticulum in the endocytic system, or in secreted form.The secreted form of MOG may trigger autoimmunity if released into the cerebrospinal fluid and periphery. MOG is thought to be a key target for autoantibodies and cell-mediated immune responses in inflammatory demyelinating diseases such as multiple sclerosis (MS) and is therefore widely studied in this field.The MOG (35-55) fragment is the most potent auto-antigenic region of MOG, and the most effective at inducing experimental autoimmune/allergic encephalomyelitis (EAE), an animal model that resembles MS. This peptide has a free carboxylic acid at the C-terminus, an amide version is also available in our catalogue.
    Formule :C118H177N35O29S
    Degré de pureté :Min. 95%
    Couleur et forme :Powder
    Masse moléculaire :2,581.95 g/mol

    Ref: 3D-CRB1000205

    1mg
    346,00€
    5mg
    452,00€
    10mg
    543,00€
    25mg
    633,00€
    500µg
    282,00€
  • [5-FAM]-GLP-1


    Glucagon-like peptide (GLP)-1 is a gastrointestinal peptide hormone with multiple roles in relation to metabolism. The primary role of GLP-1 is increasing insulin secretion in the presence of high plasma glucose levels, in addition, GLP-1 also suppresses glucagon secretion from the pancreas. GLP-1 slows down gastric emptying and regulates appetite, both valuable in reducing food intake and body weight. These roles of GLP-1 make it a useful target in the management of type 2 diabetes mellitus (T2DM).GLP-1 exerts its effects by binding to and activating the class B G protein-coupled receptor (GPCR):  GLP-1 receptor (GLP-1R). Receptor activation in turn activates signalling pathways which culminates in insulin secretion via CAMP and Ca2+ signalling.Recently evidence has increased for GLP-1 playing a cardio-protective role as well as regulating immune responses and even in kidney function. GLP-1 may also exert neuroprotective and neurotropic effects as it can decrease endogenous levels of amyloid-β (Aβ) and prevent Aβ-induced cell death.This peptide contains N-terminal 5-Carboxyfluorescein (5-FAM), a widely used green fluorescent tag.
    Degré de pureté :Min. 95%
    Couleur et forme :Powder
    Masse moléculaire :4,467.1 g/mol

    Ref: 3D-CRB1100880

    1mg
    543,00€
    100µg
    386,00€
    500µg
    470,00€
  • AF488 6xHis Tag


    [AF488] 6xHis Tag, composed of a hexa-histidine tag and the fluorescent dye, Alexa Fluor 488 (AF488).
    Degré de pureté :Min. 95%
    Masse moléculaire :1,356.4 g/mol

    Ref: 3D-CRB1111525

    1mg
    651,00€
    100µg
    386,00€
    500µg
    470,00€
  • H-PQQPQQSFPQQQRP-NH2


    Peptide H-PQQPQQSFPQQQRP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45781

    ne
    À demander
  • SMAC/DIABLO-[Cys(AF647)]


    SMAC/DIABLO-[Cys(AF647)] is a pro-apoptotic peptide that is derived from the mitochondrial protein known either as Second Mitochondria-Derived Activator of Caspases (Smac) or Direct IAP Binding Protein with low isoelectric point, pI (DIABLO). During apoptosis the mitochondria has increased permeability to Smac/DIABLO, which causes the protein to diffuse into the cytosol. Here, Smac/DIABLO adheres to Inhibitors of apoptosis proteins (IAPs) and prevents them from binding to caspases, which in turn accentuates apoptosis.This peptide has a C-terminal cysteine linker labelled with AF647, which is a bright, far-red-fluorescent dye with excitation between 594 nm and 633 nm.
    Degré de pureté :Min. 95%
    Couleur et forme :Powder
    Masse moléculaire :1,427.7 g/mol

    Ref: 3D-CRB1110326

    1mg
    543,00€
    100µg
    386,00€
    500µg
    470,00€
  • SBP1


    Fragment of the angiotensin-converting enzyme 2 (ACE2) peptidase domain (PD) alpha1 helix, a domain important for the interaction of ACE2 with the severe acute respiratory syndrome (SARS coronavirus receptor binding domain (SARS-CoV-2-RBD). SBP1 associates with the SARS-CoV-2-RBD with nanomolar affinity and can potentially block the key mechanism by which SARS CoV-2 initiates entry into human cells.
    Degré de pureté :Min. 95%
    Couleur et forme :Powder

    Ref: 3D-CRB1001498

    1mg
    282,00€
    500µg
    206,00€
  • GGG-[K(5-TAMRA)] C-terminal Sortagging


    This C-terminal Sortagging peptide acts as a (oligo)glycine nucleophile in the final steps of a sortagging protein labelling reaction. This reaction results in the [Lys(5-TAMRA)]- fluorescent moiety being attached to the C-terminus of the target protein or peptide.A substrate peptide containing the LPXTG motif is recognised and cleaved by the enzyme Sortase A (SrtA) from Staphylococcus aureus. The catalytic cysteine residue in the active site of SrtA, serves as a nucleophile to cleave the peptide bond between threonine and glycine of the substrate peptide. Cleavage results in the formation of a thioacyl intermediate between the substrate peptide and SrtA. This intermediate is then resolved by the N-terminus of this (oligo)glycine nucleophile peptide, resulting in the creation of a new peptide bond that links the substrate peptide to this peptide and its fluorescent dye.  This method of protein labelling is known as sortagging.5-Carboxytetramethylrhodamine (5-TAMRA) is a widely used fluorescent dye which excites at 546 nm and emits at 579 nm.
    Degré de pureté :Min. 95%
    Couleur et forme :Powder
    Masse moléculaire :728.3 g/mol

    Ref: 3D-CRB1100651

    100µg
    386,00€
    500µg
    470,00€
  • AF488 Insulin


    Insulin is a peptide hormone produced by β cells of the pancreatic islets that regulates carbohydrates metabolism. It is a heterodimer of an A-chain and a B-chain, which are linked together by disulfide bonds. Insulin stimulates the absorption of glucose from the blood into fat, muscle and liver cells where it is converted into either glycogen or fat.Insulin is secreted in the blood as a response to high level of blood glucose resulting in enhanced glucose uptake and metabolism in the cells so to reduce blood glucose levels. Circulating insulin also affects the synthesis of proteins in many tissues. Low blood insulin levels result in catabolism, particularly of reserve body fat. A decrease or absence of insulin activity results in diabetes mellitus, a condition of high blood sugar level (hyperglycaemia).N-terminal chain B labelled with AF488. AF488 dye is a bright, green-fluorescent dye with excitation maxima around 490 and emission maxima around 525. AF488 dye is pH-insensitive over a wide molar range.
    Degré de pureté :Min. 95%
    Masse moléculaire :6,319.6 g/mol

    Ref: 3D-CRB1110900

    100µg
    597,00€
    500µg
    891,00€
  • GPS1573


    GPS1573 is a potent and dose-dependent peptide antagonist of adrenocorticotrophic (ACTH) -stimulated melanocortin type 2 receptor (MC2R). Along with GPS1574, GPS1773 is an ACTH analogue and as such antagonises MC2R in the nanomolar range.The clinical relevance of GPS1573 is related to Cushing's disease and syndrome, which are both associated with a hypercortisolemic state. Selective antagonism of MC2R using GPS1573 may be a novel treatment modality for Cushing's disease and syndrome.
    Degré de pureté :Min. 95%
    Couleur et forme :Powder

    Ref: 3D-CRB1000575

    1mg
    282,00€
    500µg
    206,00€
  • H-RHSVV-NH2


    Peptide H-RHSVV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45637

    ne
    À demander
  • H-TVQDALSSVQESDIAVVAR^-OH


    Peptide H-TVQDALSSVQESDIAVVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40229

    ne
    À demander
  • H-VLLQTLR^-OH


    Peptide H-VLLQTLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48341

    ne
    À demander
  • [5-FAM]-RPKPQQFFGLM-NH2


    Substance P (SP) is a peptide that is highly conserved across the animal kingdom and is involved in a number of inflammatory and growth promoting processes. SP has a net positive charge at physiological pH, it is an amphiphilic peptide with positively charged residues at the N-terminus and hydrophobic residues at the C-terminus, this controls how it interacts with cell membranes. SP is relatively stable in plasma (several hours) but has a short half-life in tissues (seconds/minutes).SP is encoded by the TAC1 gene and is a member of the tachykinin peptide hormone family. SP is expressed by many cell types including: neurons- astrocytes- microglia- epithelial cells- endothelial cells- immune cells such as T cells and macrophages- dendritic cells and eosinophils and some stem cells and progenitor cells. The huge variety of cell types expressing SP suggest it is involved in a wide variety of physiological and pathophysiological functions.SP mediates its functions by interacting with members of the neurokinin (NK) family of G protein-coupled receptors with high selectivity. Among these, SP binds to NK1R with the highest affinity, this receptor is expressed in a wide range of tissue types.[5-FAM]-Substance P contains 5-Carboxyfluorescein (5-FAM), a widely used green fluorescent tag.
    Degré de pureté :Min. 95%
    Couleur et forme :Powder
    Masse moléculaire :1,704.8 g/mol

    Ref: 3D-CRB1100555

    100µg
    206,00€
    500µg
    282,00€
  • H-RHFWQQDEPPQSPWDR^-OH


    Peptide H-RHFWQQDEPPQSPWDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41131

    ne
    À demander
  • Acetyl-Alpha-2-antiplasmin-[AF680]


    Alpha-2-antiplasmin (alpha2AP), a member of the serine protease inhibitor (SERPIN) superfamily, is the main inhibitor of the fibrinolytic enzyme plasmin as well as an inhibitor of trypsin, elastase, and C protein. It plays a crucial role in reducing plasmin production and activity and thus inhibiting fibrinolysis.alpha2AP is synthesized in the liver and secreted as a single-chain glycoprotein, containing 11-14% carbohydrate, with a methionine (Met) as its N-terminus (Met-alpha2AP). The N-terminus of alpha2AP is involved in the incorporation of alpha2AP into a clot and the C-terminus is involved in the initial interaction of alpha2AP with plasmin(ogen). Circulating alpha2AP undergoes both N-and C-terminal modifications, which alter its activity. Increased concentrations of a2AP are associated with a higher risk of cardiovascular diseases.
    Degré de pureté :Min. 95%
    Masse moléculaire :2,735.2 g/mol

    Ref: 3D-CRB1110405

    100µg
    386,00€
    500µg
    470,00€
  • (Tos-GPR)2-[Rh110]


    Fluorogenic substrate for thrombin that when in its intact state does not fluoresce, however upon cleavage by thrombin in 2 successive steps, Rhodamine 110 is released to allow fluorescence.Thrombin is a multifunctional serine protease and is the principal enzyme of hemostasis. It catalyzes the conversion of fibrinogen to fibrin and activates procoagulant factors V, VIII, XI, and XIII. When bound to thrombomodulin, it activates protein C, an anticoagulant zymogen. Thrombin also activates platelets, regulates endothelial cell function, and has a host of direct actions on other cells. Thrombin has been found to act as a mediator of vascular dysfunction and inflammation in both the peripheral and the central nervous systems. Thrombin contributes to the development of cardiovascular disease, atherosclerosis and diabetes and promotes vascular dysfunction, inflammation, and neurodegeneration. Thrombin is elevated in the brains of people with Alzheimer's disease (AD) and therefore may be a therapeutic target in AD.
    Degré de pureté :Min. 95%
    Couleur et forme :Powder
    Masse moléculaire :1,259.42 g/mol

    Ref: 3D-CRB1100251

    1mg
    470,00€
    500µg
    386,00€
  • Glucagon (1-29)-[Lys(AF647)]


    Glucagon (1-29)-[Lys(AF647)] is derived from glucagon, which is a peptide hormone secreted by alpha cells located in the islet of Langerhans region of the pancreas. Glucagon is an essential catabolic hormone that is responsible for the regulation of blood glucose levels. Once released into the bloodstream, glucagon stimulates the production of hepatic glucose, which means it is considered to be a glucose-mobilizing agent. Excessive levels of glucagon can result in the development of hyperglycaemia, since the action of glucagon results in abnormally high blood glucose levels.This peptide contains AF647, structural analog to Alexa Fluor® 647 which is a widely used far-red fluorescent dye.
    Degré de pureté :Min. 95%
    Couleur et forme :Powder
    Masse moléculaire :4,750 g/mol

    Ref: 3D-CRB1101573

    100µg
    386,00€
    500µg
    470,00€
  • hsBCL9CT-24


    Blocks the Wnt pathway and inhibits the expression of TGFb1 in CT26 colon carcinoma cells, leading to the reduction of CCL20 and CCL22, two TGF-b- dependent chemokines critical for Treg cell recruitment into the tumour microenvironment.  hsBCL9CT-24 shows robust antitumour efficacy across multiple in vivo models.

    Degré de pureté :Min. 95%
    Couleur et forme :Powder
    Masse moléculaire :1,629 g/mol

    Ref: 3D-CRB1001394

    1mg
    597,00€
    500µg
    470,00€
  • Angiotensin (Human, 1-7)

    CAS :
    Angiotensin 1-7 (Ang-(1-7)) is a component of the renin angiotensin system RAS. Ang-(1-7) is produced by angiotensin-converting enzyme 2 (ACE2), from the angiotensin II (Ang-II) peptide, as well as by prolylendopeptidase (PEP) and neutral endopeptidase (NEP) which produce Ang-(1-7) directly from angiotensin I (Ang-I).Ang-(1-7) broadly opposes Ang-II actions. Ang-(1-7) has vasodilatory and anti-oxidative effects, and exerts protective actions in hypertension, diabetes, and other cardiovascular disorders, Ang-(1-7) therefore represents a promising therapeutic target for cardiovascular and metabolic diseases. Ang-(1-7) exerts its actions via its G-protein-coupled receptor, Mas. This novel arm of the RAS has effects that counterbalance those mediated by the classical ACE/Ang-II pathway.
    Formule :C41H62N12O11
    Degré de pureté :Min. 95%
    Couleur et forme :Powder
    Masse moléculaire :899.01 g/mol

    Ref: 3D-CRB1000803

    1mg
    282,00€
    500µg
    206,00€
  • RGD Peptide GRGDSPK

    CAS :
    GRGDSPK is the sequence found in cell binding region of fibronectin and many other proteins. The sequence, referred to as RGD, is critical for facilitating cell adhesion.-RGD peptide is an adhesive peptide which can be used in a biomaterial context to attach cells to a range of materials. RGD has many applications including as an antigen for integrin adhesion of thymocytes to thymic epithelial cells. RGD can be used as a blocking peptide to study bacteria and fibronectin. RGD can also be used on collagen-coated plates for study of integrins' role in progenitor cell differentiation. Delivery of RGD peptide inhibits bone mineralization in a dose-dependent manner so GRGDSPK is used to study the role of integrins in bone formation. The presence of RGD peptide dramatically alters bone morphology, with a disruption of osteoblast and mineralized matrix organisation. RGD is a vital research tool in bone formation and integrin.
    Formule :C28H49N11O11
    Degré de pureté :Min. 95%
    Couleur et forme :Powder
    Masse moléculaire :715.4 g/mol

    Ref: 3D-CRB1000549

    1mg
    282,00€
    500µg
    206,00€
  • Des-n-Octanoyl-[Ser3]-Ghrelin (Rat)


    The peptide Des-n-octanoyl-[Ser3]-ghrelin (DOG) is a synthetic analogue of ghrelin, the only known natural ligand for the growth hormone secretagogue receptor. DOG binds to the ghrelin receptor and activates it, thereby stimulating growth hormone release from the anterior pituitary gland. In a rat model, DOG counteracts weight gain caused by high-fat diet. It also increases insulin sensitivity in diabetic rats and acts as an appetite suppressant in non-diabetic rats. As such, this peptide has potential as a therapeutic agent for obesity and diabetes.
    Formule :C139H231N45O41
    Degré de pureté :Min. 95%
    Masse moléculaire :3,188.67 g/mol

    Ref: 3D-PGH-3654-PI

    500µg
    320,00€
  • Fmoc-Cys(tBu)-Wang Resin (100-200 mesh) 1% DVB


    Fmoc-Cys(tBu)-Wang Resin (100-200 mesh) is a research tool for use in the synthesis of peptides and proteins. It is an activated resin that can be used to synthesize peptides with a C-terminal cysteine. The resin is suitable for the coupling of amines, alcohols, thiols, phosphates and other compounds. Fmoc-Cys(tBu)-Wang Resin (100-200 mesh) has been shown to be an effective inhibitor of ion channels and may have potential as a therapeutic drug for the treatment of epilepsy.

    Degré de pureté :Min. 95%

    Ref: 3D-RFC-1341-PI

    1g
    298,00€
    5g
    936,00€
  • Fmoc-Gly-Pro-OH

    CAS :
    This is a vivitide catalogue product. Please send your vivitide product enquiry to sales@vivitide.com for an up-to-date price and availability.
    Formule :C22H22N2O5
    Degré de pureté :Min. 95%
    Masse moléculaire :394.43 g/mol

    Ref: 3D-FGP-1917-PI

    1g
    277,00€
    5g
    730,00€
  • Ac-GPTHLFQPSLVLDMAKVLD-NH2


    Peptide Ac-GPTHLFQPSLVLDMAKVLD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44156

    ne
    À demander
  • H-Phe-2-ClTrt-Resin (200-400 mesh) 1% DVB


    H-Phe-2-ClTrt-Resin (200-400 mesh) 1% DVB is a resin for peptide synthesis. It can be used in the synthesis of thiols, building blocks, alcohols and amines with 1% DVB.
    Degré de pureté :Min. 95%

    Ref: 3D-RHF-1095-PI

    1g
    197,00€
    5g
    653,00€
  • LCBiot-GGG-OH


    Peptide LCBiot-GGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP43714

    ne
    À demander
  • H-L^NILNNNYK^-OH


    Peptide H-L^NILNNNYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47558

    ne
    À demander
  • H-LPTDSELAPR^-OH


    Peptide H-LPTDSELAPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40555

    ne
    À demander