Peptides
Les peptides sont des chaînes courtes d'acides aminés liées par des liaisons peptidiques, jouant un rôle essentiel en tant que molécules biologiques dans divers processus cellulaires. Ils fonctionnent comme hormones, neurotransmetteurs et molécules de signalisation, et sont largement utilisés dans les applications thérapeutiques et diagnostiques. Les peptides sont également cruciaux dans la recherche pour étudier les interactions protéiques, les activités enzymatiques et les voies de signalisation cellulaire. Chez CymitQuimica, nous proposons une large sélection de peptides de haute qualité pour soutenir vos besoins en recherche et développement en biotechnologie et en pharmacie.
Sous-catégories appartenant à la catégorie "Peptides"
30315 produits trouvés pour "Peptides"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Ac-LRGG-CHO
Peptide Ac-LRGG-CHO is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QGVDDAFYTLVR^^-OH
<p>Peptide H-QGVDDAFYTLVR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HIF1 α 788-822
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :3,830.25 g/molH-VGRP^EWWMDYQK^-OH
Peptide H-VGRP^EWWMDYQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VAIDVGYR^-OH
Peptide H-VAIDVGYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SPLTTGVYVK^-OH
<p>Peptide H-SPLTTGVYVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SSFTVQDLKPFTEYVFR^-OH
<p>Peptide H-SSFTVQDLKPFTEYVFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EQLTPLI^K-OH
<p>Peptide H-EQLTPLI^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-QVPLRPMTY-OH
<p>Peptide Ac-QVPLRPMTY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-APLTKPLK^-OH
<p>Peptide H-APLTKPLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-EDQVDPRLIDGK-OH
<p>Peptide LCBiot-EDQVDPRLIDGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ENATVAHL^VGALR-OH
<p>Peptide H-ENATVAHL^VGALR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ENATVAHLVGALR^-OH
Peptide H-ENATVAHLVGALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-STRDPLSEITK^-OH
Peptide H-STRDPLSEITK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FL^SLDYIPQR-OH
<p>Peptide H-FL^SLDYIPQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CS-NH2
<p>Peptide Ac-CS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-LSHVLYSIAFED-NH2
<p>Peptide Ac-LSHVLYSIAFED-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SFNPNSPGK^-OH
Peptide H-SFNPNSPGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HHAAYVNNLNVTEEK^-OH
<p>Peptide H-HHAAYVNNLNVTEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-ELSEALGQIFDSQR-OH
<p>Peptide LCBiot-ELSEALGQIFDSQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EALQGVGDMGR^-OH
<p>Peptide H-EALQGVGDMGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Glu(Glu-OH)-OH
CAS :H-Glu(Glu-OH)-OH is a synthetic amino acid that is currently being investigated as a diagnostic agent for the detection of intracellular protein degradation by matrix metalloproteinase-9 (MMP-9). H-Glu(Glu-OH)-OH is taken up by cells in a concentration and time dependent manner, with an uptake rate of approximately 1.6 x 10^6 molecules per cell per hour. The uptake mechanism is not yet known, but has been hypothesized to be due to receptor binding. H-Glu(Glu-OH)-OH binds to cerebellar granule cells and alters mitochondrial metabolism, which may be related to its effects on the ubiquitin proteasome pathway. This compound also has diagnostic potential for atherosclerosis and glutamate transport disorders.Formule :C10H16N2O7Degré de pureté :Min. 95%Masse moléculaire :276.24 g/molPalmitic Acid-RTARSLRRRFT-NH2
Peptide Palmitic Acid-RTARSLRRRFT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVQAFQFTDK^-OH
<p>Peptide H-LVQAFQFTDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVGVGK^SAL-OH
<p>Peptide H-AVGVGK^SAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Influenza NP (482 - 489)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C44H55N9O15Masse moléculaire :949.98 g/molH-DRV^YI^HPFHL-OH
Peptide H-DRV^YI^HPFHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 72
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,736.9 g/molH-YSSDYFQAPSDYR^-OH
<p>Peptide H-YSSDYFQAPSDYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HCV NS5B 2727-2735 (HLA-A*02:01)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-AIWNVINWENVSQR^-OH
<p>Peptide H-AIWNVINWENVSQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SART3 309-317 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolHepcidin/LEAP-1 (Human) (Bulk)
CAS :<p>Human Hepcidin peptide hormone product also know as LEAP-1 (liver-expressed antimicrobial peptide), where the disulfides are formed by random oxidation. Hepcidin is a peptide hormone that is synthesized in the liver and is an important regulator of iron homeostasis. Through binding to ferroportin Hepcidin prevents the exportation of iron thus reducing the amount of circulating iron. Furthermore through inflammatory cytokine induction Hepcidin leads to the internalization and degradation of ferroportin thus further reducing the amount of iron in circulation. This in turn make conditions unfavourable to invading pathogens. This demonstrates Hepcidin's ability as an anti-microbial peptide. This antimicrobial behaviour can be used in research into the elimination of pathogens but also in combatting diseases where iron dysregulation is prevalant.</p>Formule :C113H170N34O31S9Degré de pureté :Min. 95%Masse moléculaire :2,789.4 g/molH-DHIGTR^-OH
<p>Peptide H-DHIGTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>FGF 2 Human
Fibroblast Growth Factor-2 Human Recombinant (FGF-2) produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 154 amino acids and having a molecular mass of 17.2kDa.Degré de pureté :>98% By Sds-PageFRETS-VWF73 (0.1 mg vial)
FRETS-VWF73 is a fluorogenic peptide substrate used to measure ADAMTS13 activity in a FRET assay. Measuring the activity of ADAMTS13, a metalloprotease that cleaves von Willebrand factor (VWF), is important in diagnostic applications, particularly for patients with suspected thrombotic microangiopathies.Formule :C370H583N103O113SDegré de pureté :Min. 95%Masse moléculaire :8,314.3 g/molH-IILEGTER^-OH
<p>Peptide H-IILEGTER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-LRLRGG-CHO
<p>Peptide Ac-LRLRGG-CHO is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HIV - 1 MN ENV - 140
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,751.1 g/molLCBiot-FPWFPLPSPYGN-OH
<p>Peptide LCBiot-FPWFPLPSPYGN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVGA^VGVGK^-OH
<p>Peptide H-VVGA^VGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSTIALALGVER^-OH
<p>Peptide H-LSTIALALGVER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSPAINVAMHVFR^-OH
<p>Peptide H-GSPAINVAMHVFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YGRKKRRQRRRC-NH2
<p>Peptide H-YGRKKRRQRRRC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Neuropeptide VF (124-131) (human)
CAS :Neuropeptide: Neuropeptides are small signaling molecules produced and released by neurons engaged in many physiological functions. Indeed, neuropeptides act on neural substrates such as G protein-coupled receptors (GPCRs), tyrosine-kinase receptor, insuline-like peptides and also ion channels. Actions of Neuropeptides result in slow-onset, long-lasting modulation of synaptic transmission. Pro-FMRFamide-related neuropeptide VF: Pro-FMRFamide-related neuropeptide VF also called neuropeptide VF precursor are expressed in neurons in mediobasal hypothalamus. Neuropeptide VF precursor is a propeptide which is cleaved in three others peptide: Neuropeptide RFRP-1, RFRP-2 and RFRP-3. Neuropeptide RFRP-3 (124-131): Neuropeptide RFRP-3 acts as a potent synthesis and secretion gonadotropin inhibitor. Neuropeptide RFRP-3 inhibit forskolin-induced production of cAMP and progesterone production in human cells. Neuropeptide RFRP-3 (124-131) is a part of RFRP-3 and is useful in opioid research.Formule :C45H72N14O10Masse moléculaire :969.16 g/molH-LVVVGAGDVGK^-OH
<p>Peptide H-LVVVGAGDVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CYSQFLDKYLQSTRV-OH
Peptide Ac-CYSQFLDKYLQSTRV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RPHFPQFSYSASGTA^-OH
Peptide H-RPHFPQFSYSASGTA^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GDYPLEAVR^-OH
<p>Peptide H-GDYPLEAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LTLLAPLNSVFK^-OH
<p>Peptide H-LTLLAPLNSVFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>MAGE-3 (119-134)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Ac-CMKKDDQIAAAIALRGMAKDGKFAVK-NH2
<p>Peptide Ac-CMKKDDQIAAAIALRGMAKDGKFAVK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LQHLVNEL^THDIITK-OH
<p>Peptide H-LQHLVNEL^THDIITK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GHFPLAER^-OH
<p>Peptide H-GHFPLAER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SIPQVSPVR^-OH
<p>Peptide H-SIPQVSPVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MDILSYMR^-OH
<p>Peptide H-MDILSYMR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2
Peptide H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGAQATWTELPWPHEK^-OH
Peptide H-SGAQATWTELPWPHEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YVYIAELLAHK^-OH
Peptide H-YVYIAELLAHK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVAVYADQAK^-OH
<p>Peptide H-AVAVYADQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVIDDAFAR^-OH
Peptide H-AVIDDAFAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HIV-1 gag Protein p24 (65-73) (isolates MAL/U455)
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C44H79N11O14S2Masse moléculaire :1,050.31 g/molH-DLATVYVDVLK^-OH
<p>Peptide H-DLATVYVDVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-IDMVD-OH
Peptide Ac-IDMVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EEQY^NSTYR-OH
Peptide H-EEQY^NSTYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5Azido-RKKRRQRRR-NH2
<p>Peptide 5Azido-RKKRRQRRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>RK9, p17 Gag (20 - 28)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C45H86N18O10Masse moléculaire :1,039.3 g/mol5Fam-VIFDANAPVAVR-OH
<p>Peptide 5Fam-VIFDANAPVAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-KNIVTPRTPPPSQGK-NH2
<p>Peptide LCBiot-KNIVTPRTPPPSQGK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ANLQSVPHASASRPR^-OH
<p>Peptide H-ANLQSVPHASASRPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVSSIEQK^-OH
Peptide H-VVSSIEQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PWK-AMC
Peptide H-PWK-AMC is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-Arg-Leu-Arg-MCA
<p>Peptide Ac-Arg-Leu-Arg-MCA is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-Ile-His-Ile-His-Ile-Gln-Ile-NH2
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C43H71O9N13Masse moléculaire :914.11 g/molH-SGTDVDAANLR^-OH
<p>Peptide H-SGTDVDAANLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IVTDLTK^-OH
<p>Peptide H-IVTDLTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FATVEVTDK^-OH
<p>Peptide H-FATVEVTDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVTDLTK^-OH
Peptide H-LVTDLTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GQAEVTQDPAPLLR^-OH
<p>Peptide H-GQAEVTQDPAPLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALDFAVSEYNK^-OH
<p>Peptide H-ALDFAVSEYNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 56
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,566.7 g/molRuth-SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP-NH2
<p>Peptide Ruth-SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LIQGAPTIR^-OH
<p>Peptide H-LIQGAPTIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTTLITNLSSVLK^-OH
<p>Peptide H-GTTLITNLSSVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Cyclo[Arg-Gly-Asp-D-Phe-Lys(dPEG®4)]
<p>Cyclo[Arg-Gly-Asp-D-Phe-Lys(dPEG®4)] is a peptide containing polyethylene glycol (PEG) as spacer to alter their pharmacokinetic properties and pharmodynamics.</p>Formule :C38H62N10O12Degré de pureté :Min. 95%Masse moléculaire :850.98 g/molH-GTYSTTVTGR^-OH
<p>Peptide H-GTYSTTVTGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-YPYDVPDYAC-OH
Peptide Ac-YPYDVPDYAC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTTGADVR^-OH
<p>Peptide H-LTTGADVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVVVGADGVGK^-OH
Peptide H-LVVVGADGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TPLTATLSK^-OH
Peptide H-TPLTATLSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NVALLALPR^-OH
Peptide H-NVALLALPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GEEPLYWSFPAKKK-NH2
<p>Peptide H-GEEPLYWSFPAKKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-[Lys-Leu-Ala-Lys-Leu-Ala-Lys]2-Gly-Phe-Leu-Gly-(Cys-Gln-Thr-Pro-Tyr-Tyr-Met-Asn-Thr-Cys)-OH
<p>This peptide is a cell-penetrating peptide (CPP) that is derived from the amino acid sequence of the human protein, integrin alpha 4. It binds to the α4β1 integrin receptor on the surface of cancer cells and causes apoptosis. This CPP can also be used as a target for various other biochemicals, such as chemotherapeutic agents, radionuclides, and antibodies, which can then bind to this target and induce apoptosis in cancer cells.</p>Formule :C142H234N36O35S3Degré de pureté :Min. 95%Masse moléculaire :3,101.86 g/molAc-CEQKLISEEDL-NH2
<p>Peptide Ac-CEQKLISEEDL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NEPEK^-OH
<p>Peptide H-NEPEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DRV^YIHPFH-OH
<p>Peptide H-DRV^YIHPFH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-LAKAVDGYVKPQIKQ-NH2
<p>Peptide LCBiot-LAKAVDGYVKPQIKQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NILTSNNIDVK^-OH
<p>Peptide H-NILTSNNIDVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ESQAYYDGR^-OH
<p>Peptide H-ESQAYYDGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SSEDPNEDIVER^-OH
Peptide H-SSEDPNEDIVER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CAQK^-NH2
Peptide Ac-CAQK^-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGGDLGTYVINK^-OH
Peptide H-LGGDLGTYVINK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CTQRGNVAKTSRNAPEEK-NH2
Peptide Ac-CTQRGNVAKTSRNAPEEK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GNFHAVYR^-OH
Peptide H-GNFHAVYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-TNL-NH2
<p>Peptide Ac-TNL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SGRGKGGKGLGKGGAKRHRKVL-NH2
<p>Peptide H-SGRGKGGKGLGKGGAKRHRKVL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-WDCCPGCCK-NH2
Peptide Ac-WDCCPGCCK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SARS-CoV-2 Antigen Peptide NCAP (LLNKHIDAYKTFPPTEPK)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C99H154N24O27Masse moléculaire :2,112.55 g/molH-LLVEELPLR^-OH
Peptide H-LLVEELPLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALVILAK^-OH
Peptide H-ALVILAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVDGYVKPQIK^-OH
<p>Peptide H-AVDGYVKPQIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DITP^TLTLYVGK^-OH
<p>Peptide H-DITP^TLTLYVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>BD-2, recombinant Human
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C188H305N55O50S6Masse moléculaire :4,328.23 g/molH-NGLHLPSYSPYPR^-OH
<p>Peptide H-NGLHLPSYSPYPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RSGPPGL^QGRL^QRL^L^QASGNHAAGIL^TM-NH2
Peptide H-RSGPPGL^QGRL^QRL^L^QASGNHAAGIL^TM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 93 (FTSQYRIQGKLEYRH)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,927.2 g/molH-TLVVHEK^-OH
<p>Peptide H-TLVVHEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-TYFAVLM-NH2
<p>Peptide Ac-TYFAVLM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-MTATHAVDEAVS-NH2
Peptide Ac-MTATHAVDEAVS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.FMOC-PQP-OH
<p>Peptide FMOC-PQP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CONJUGATE B CONTAINING CAMPTOTHECIN-GLY-SUCCINATE
<p>Peptide CONJUGATE B CONTAINING CAMPTOTHECIN-GLY-SUCCINATE is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 13 (RVSQPSLILVSQYTP)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,688 g/molSIVmac239 - 120
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,884.1 g/molH-AAIQAL^R-OH
<p>Peptide H-AAIQAL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-LLGIWGC-NH2
Peptide LCBiot-LLGIWGC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EAEAAMFHR^-OH
<p>Peptide H-EAEAAMFHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-AESPKKP-OH
Peptide LCBiot-AESPKKP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 85 (VELRQYDPVAALFFF)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,815.1 g/molCyclin-A1 (385-395)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-RRPHFP^QFSYSASGTA-OH
<p>Peptide H-RRPHFP^QFSYSASGTA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPETLCGAELVDALQFVCGDR^-OH
<p>Peptide H-GPETLCGAELVDALQFVCGDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VTMLISGR^-OH
<p>Peptide H-VTMLISGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 122 (PPWQAGILARNLVPM)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,663 g/molBivalirudin (3-20)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Boc-Dap-OtBu hydrochloride salt
CAS :Boc-Dap-OtBu hydrochloride salt is a chemical that is synthesized by anhydride and trifluoroacetic acid. It can be used in the laboratory for protein visualization, as well as to detect proteins using LC-MS. The presence of trifluoroacetic acid makes the Boc-Dap-OtBu hydrochloride salt fluorescent, which makes it possible to visualize the reaction products under UV light. This chemical is often used in fluorescence spectrometry to identify amino acids and other compounds.Formule :C12H24N2O4Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :260.33 g/molAc-CMSGTGIRSVTGTPY-NH2
<p>Peptide Ac-CMSGTGIRSVTGTPY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 22 (SEVENVSVNVHNPTG)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,581.7 g/molAc-CTPYDINQM-NH2
Peptide Ac-CTPYDINQM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EEAPSLRPAPPPISGGGYR^-OH
<p>Peptide H-EEAPSLRPAPPPISGGGYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>AYPGKF-NH2
CAS :Peptide AYPGKF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formule :C34H48N8O7Masse moléculaire :680.79 g/molLeu-Thr-Ile-Ile-Pro-Gln-Asp-Pro-Ile-Leu-Phe-Ser-Gl
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C82H136N20O23Masse moléculaire :1,770.08 g/molAc-CR-NH2
<p>Peptide Ac-CR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGGGGC-NH2
Peptide H-GGGGGC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HIV - 1 MN ENV - 170
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMasse moléculaire :1,897.4 g/molH-LLLASPR^-OH
Peptide H-LLLASPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.WT1 126-134 mutant (HLA-A*02:01) 126Y
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C55H74N10O13SMasse moléculaire :1,115.3 g/molH-IL^GG-NH2
<p>Peptide H-IL^GG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HIV - 1 MN ENV - 176
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,658.9 g/molH-QDGNEEMGGITQTPY-NTPEGBiot
<p>Peptide H-QDGNEEMGGITQTPY-NTPEGBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Trp-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Trp-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin that is used in the synthesis of peptides. It is an alcohol and amine-containing resin which is typically used as a building block for peptide synthesis. The H-Trp side chain in this resin can be cleaved with thiols to yield a free Trp residue.Degré de pureté :Min. 95%H-ELYETASELPR^-OH
Peptide H-ELYETASELPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TGDIVEFVCK^-OH
<p>Peptide H-TGDIVEFVCK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPLTTPVGGGIR^-OH
<p>Peptide H-GPLTTPVGGGIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PVDEALR^-OH
<p>Peptide H-PVDEALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TETSQVAPA^-OH
<p>Peptide H-TETSQVAPA^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ATQASQEY^-OH
Peptide H-ATQASQEY^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Lys-Leu-Val-Val-Val-Gly-Ala-Cys-Gly-Val
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C42H77N11O11S1Masse moléculaire :944.19 g/molSIVmac239 - 99
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,735 g/molH-LEDVFAGK^-OH
Peptide H-LEDVFAGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biotinylated Vn96 peptide, patent WO 2012/126118
<p>A kit for releasing EVs from their bound state with the Vn96 peptide.</p>Degré de pureté :Min. 95%H-TTYADFIASGRTGRRNSIHD-NH2
<p>Peptide H-TTYADFIASGRTGRRNSIHD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 23 (NVSVNVHNPTGRSIC)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,596.8 g/molCMVpp65 - 26 (SICPSQEPMSIYVYA)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Masse moléculaire :1,688 g/molAc-RGG-CHO
<p>Peptide Ac-RGG-CHO is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AEFAEVSK^-OH
<p>Peptide H-AEFAEVSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CRQIKIWFQNRRMKWKK-NH2
Peptide Ac-CRQIKIWFQNRRMKWKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VADFGLAR^-OH
<p>Peptide H-VADFGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-ARTEVY-NH2
Peptide Ac-ARTEVY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-RFAAAAA-OH
<p>Peptide Ac-RFAAAAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RPK^PQQFFGLM-OH
<p>Peptide H-RPK^PQQFFGLM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-VTLQ-NH2
Peptide Ac-VTLQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CGEEWSQDLHSSGRTDLRYS-NH2
Peptide Ac-CGEEWSQDLHSSGRTDLRYS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YMVIQGEPGAVIR^-OH
<p>Peptide H-YMVIQGEPGAVIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Microtubule-Associated Protein (142-161)
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C86H147N23O31Masse moléculaire :1,999.25 g/molFluor-KKALRRQETVDAL-OH
Peptide Fluor-KKALRRQETVDAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Apelin-36
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C184H297N69O43SMasse moléculaire :4,195.9 g/molH-TGISPLALI^K-OH
<p>Peptide H-TGISPLALI^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-LTERHKILHRLLQE-NH2
Peptide LCBiot-LTERHKILHRLLQE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Myelin Basic Protein (1-20)
<p>The myelin sheath which is located in both the Central Nervous System (CNS) and the Peripheral Nervous System is crucial for neural insulation and the salutatory conduction of nerve impulses. When this myelin sheath is destroyed neurodegeneration and conduction failure occur. This can be observed in demyelinating diseases in the CNS such as: acute disseminated encephalomyelitis and multiple sclerosis and within the PNS: Guillain–Barré syndrome and Charcot–Marie–Tooth disease.<br>Myelin Basic Protein (MBP) from which this product is derived is the second most abundant protein in myelin. It has been found to be an intrinsically disordered protein and depending on the environmental conditions it can change its conformation. It also folds into ⍺-helical structures which allow MBP to bind tightly to lipid bilayer surfaces. MBP also interacts with other proteins, namely cytoskeletal proteins and calmodulin and may be involved in signalling pathways.<br>Although more research needs to be carried out, it is thought that MBP significantly contributes to the pathogenesis of multiple sclerosis. As MBP is an autoantigen it can be recognized and cleaved by autoantibodies and is a substrate for the immunoproteasome. Additional research has found that post-translational modifications of MBP such as the removal of arginine are increased in and may be involved in the pathogenesis of multiple sclerosis. Therefore this protein derived from MBP can be used to mimic Neurodegenerative disease phenotypes in research and animal models.</p>Formule :C92H156N30O32SDegré de pureté :Min. 95%Masse moléculaire :2,226.51 g/molH-DFEIISDTK^-OH
<p>Peptide H-DFEIISDTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VISPSEDR^-OH
Peptide H-VISPSEDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VEEQEPELTSTPNFVVEVIK^-OH
<p>Peptide H-VEEQEPELTSTPNFVVEVIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TAVNALWGK^-OH
Peptide H-TAVNALWGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GILFVGSGVSGGEEGAR^-OH
<p>Peptide H-GILFVGSGVSGGEEGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ASHEEVEGL^VEK^-OH
<p>Peptide H-ASHEEVEGL^VEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TLQTDSIDSFETQR^-OH
Peptide H-TLQTDSIDSFETQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VVGAVGVGK^-OH
<p>Peptide H-VVGAVGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GNLEWK^-OH
<p>Peptide H-GNLEWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGVLVQPG-NTBiot
<p>Peptide H-GGVLVQPG-NTBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-KPQTPRRRPSSPAPGPSRQSSSVGSC-NH2
Peptide Ac-KPQTPRRRPSSPAPGPSRQSSSVGSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-LPETGG-OH
<p>Peptide LCBiot-LPETGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-Lys-Val-Pro-Leu-ACC
<p>Ac-Lys-Val-Pro-Leu-ACC is a peptide used as a research tool to study protein interactions. Ac-Lys-Val-Pro-Leu-ACC binds to the extracellular domain of the human epidermal growth factor receptor (EGFR) and inhibits EGFR signaling. It blocks ligand binding and receptor activation, which prevents the phosphorylation of downstream signaling proteins. Ac-Lys-Val-Pro-Leu-ACC can be used in pharmacology to identify new drugs that inhibit EGFR signaling pathways.</p>Formule :C35H51N7O8Degré de pureté :Min. 95%Masse moléculaire :697.82 g/molH-LLIYAASSLQSGVPSR^-OH
Peptide H-LLIYAASSLQSGVPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VL^AVTDSPAR-OH
<p>Peptide H-VL^AVTDSPAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Myelin Basic Protein (87-99) (human, bovine, rat)
CAS :<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formule :C74H114N20O17Masse moléculaire :1,555.84 g/molAc-HWRGWVC-OH
<p>Peptide Ac-HWRGWVC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-NRV-NH2
<p>Peptide Ac-NRV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TPSLPTPPTREPK^-OH
Peptide H-TPSLPTPPTREPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FSLEGSR^-OH
Peptide H-FSLEGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![Cyclo[Arg-Gly-Asp-D-Phe-Lys(dPEG®4)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPCI-3790-PI.webp&w=3840&q=75)
![H-[Lys-Leu-Ala-Lys-Leu-Ala-Lys]2-Gly-Phe-Leu-Gly-(Cys-Gln-Thr-Pro-Tyr-Tyr-Met-Asn-Thr-Cys)-OH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCAN-3505-PI.webp&w=3840&q=75)
