Peptides
Sous-catégories appartenant à la catégorie "Peptides"
29634 produits trouvés pour "Peptides"
H-LLIYY^TSR^-OH
Peptide H-LLIYY^TSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-LVLRLR-OH
Peptide Ac-LVLRLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KAL^N-OH
Peptide H-KAL^N-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.DYKDDDDK
DYKDDDDK-peptide is a 8 aa length peptide used for the competitive elution of FLAG fusion proteins (with excess of free DYKDDDDK-peptide) under non-denaturing conditions.Formule :C41H60N10O20Masse moléculaire :1,012.99 g/molH-Asp-Phe-OH
CAS :H-Asp-Phe-OH is a diagnostic agent that contains the amino acid aspartame and a hydroxyl group. It is hydrolyzed in the body to form aspartic acid, phenylalanine, and methanol. The methyl ester of H-Asp-Phe-OH is hydrochloride. This compound has been used to study locomotor activity in mice and rats. Aspartame has also been shown to be an inhibitor of certain enzymes, such as fatty acid synthase, which is associated with human pathogens. The lc-ms/ms method has been used to detect H-Asp-Phe-OH metabolites in human serum samples. In addition, this compound can be used for the diagnosis of diseases such as diabetes mellitus type 2 and Alzheimer’s disease by measuring uptake into cells at enzyme activities.
Formule :C13H16N2O5Degré de pureté :Min. 95%Couleur et forme :White PowderMasse moléculaire :280.28 g/molGlutaryl-Gly-Arg-AMC hydrochloride salt
CAS :Glutaryl-Gly-Arg-AMC hydrochloride salt is a high quality, fine chemical reagent that is useful as a building block, scaffold or intermediate. It has been used in the synthesis of other complex compounds and has been shown to have potential for use in drug discovery research. Glutaryl-Gly-Arg-AMC hydrochloride salt is a versatile building block that can be used in reactions that require the presence of an amine group, such as peptide coupling. This reagent can also be used to modify the functional groups on small molecules, such as aldehydes and carboxylic acids. Glutaryl-Gly-Arg-AMC hydrochloride salt is also useful as a reaction component in the synthesis of speciality chemicals, such as pharmaceuticals and agrochemicals.Formule :C23H30N6O7•HClDegré de pureté :Min. 95 Area-%Couleur et forme :PowderMasse moléculaire :538.98 g/molMART-1 (27-35) (human)
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C37H67N9O11Masse moléculaire :814 g/molH-VFIEDVSR^-OH
Peptide H-VFIEDVSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Mca-Tyr-Val-Ala-Asp-Ala-Pro-Lys(Dnp)-OH trifluoroacetate
CAS :Please enquire for more information about Mca-Tyr-Val-Ala-Asp-Ala-Pro-Lys(Dnp)-OH trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C53H64N10O19•(C2HF3O2)xDegré de pureté :95%NmrCouleur et forme :PowderMasse moléculaire :1,145.13 g/moln-Octylpolyoxyethylene
CAS :n-Octylpolyoxyethylene (n-OPEO) is a synthetic surfactant that is used as an antimicrobial agent. It has been shown to be effective against a wide variety of bacteria, including Mycobacterium tuberculosis and Staphylococcus aureus. The mechanism by which n-OPEO exerts its antibacterial efficacy is not yet fully understood. It may inhibit the growth of bacteria by disrupting their cell membranes, or it may interfere with the synthesis of proteins needed for bacterial growth.Formule :C8H18O(C2H4O)nCouleur et forme :Clear LiquidMasse moléculaire :174.28Ac-VQIVYK-OH
Peptide Ac-VQIVYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HyNic-GLFHAIAHFIHGGWHGLIHGWYG-OH
Peptide HyNic-GLFHAIAHFIHGGWHGLIHGWYG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Glucagon (1-29)-[Lys(AF647)]
Glucagon (1-29)-[Lys(AF647)] is derived from glucagon, which is a peptide hormone secreted by alpha cells located in the islet of Langerhans region of the pancreas. Glucagon is an essential catabolic hormone that is responsible for the regulation of blood glucose levels. Once released into the bloodstream, glucagon stimulates the production of hepatic glucose, which means it is considered to be a glucose-mobilizing agent. Excessive levels of glucagon can result in the development of hyperglycaemia, since the action of glucagon results in abnormally high blood glucose levels.This peptide contains AF647, structural analog to Alexa Fluor® 647 which is a widely used far-red fluorescent dye.Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :4,750 g/molCrotonic-HFRRHL-OH
Peptide Crotonic-HFRRHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Cyclo(-D-Leu-D-Pro)
CAS :Cyclo(-D-Leu-D-Pro) is a macrolide that inhibits the growth of bacteria. It binds to the 50S ribosomal subunit and prevents the formation of an antibiotic-inhibitor complex with the enzyme cell wall synthesis that is required for cell wall biosynthesis, inhibiting protein synthesis and cell division. Cyclo(-D-Leu-D-Pro) has been shown to have antibacterial activity against the Gram negative bacterium Vibrio anguillarum. This drug has also been shown to have endophytic properties, as it was isolated from an endophytic fungus found in leaves of Eucalyptus trees. The stereoisomers of cyclo(-D-Leu-D-Pro) have different effects on bacterial cells, with one being more potent than the other.Formule :C11H18N2O2Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :210.27 g/molNeuropeptide W-23 (human)
CAS :Neuropeptide W-23 (human) is an antibody that recognizes the neuropeptide receptor, specifically the Neuropeptide Y receptor 1. The antibody binds to the Npy1 receptor and inhibits its activity. Neuropeptide W-23 (human) can be used as a research tool in cell biology and pharmacology studies.Formule :C119H183N35O28SDegré de pureté :Min. 95%Masse moléculaire :2,584.01 g/molAc-GKPIPNPLLGLDST-NH2
Peptide Ac-GKPIPNPLLGLDST-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H2N-Trp-Leu-Ser-Glu-Ala-Gly-Pro-Val-Val-Thr-Val-Ar
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C97H152N28O27Masse moléculaire :2,142.42 g/molBiot-ASRMEEVD-OH
Peptide Biot-ASRMEEVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.S-Methyl-L-thiocitrulline acetate salt
CAS :Produit contrôléS-Methyl-L-thiocitrulline acetate salt (SMTSA) is an inhibitor of the enzyme cyclase that inhibits the production of 5-hydroxytryptamine (5-HT) in the gastrointestinal tract. SMTSA has been shown to reduce 5-HT concentrations in mesenteric vessels and inhibit the physiological effects of 5-HT in rats. This drug also inhibits dopamine release from synaptosomes, which may be due to its ability to act as a competitive inhibitor of ester hydrochloride, dinucleotide phosphate, and cyclase. In addition, this drug has been shown to have a cytotoxic effect on cardiac myocytes by causing calcium influx into the cytosol and inhibiting ryanodine receptor channels.Formule :C7H15N3O2SDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :205.28 g/molMyr-RLYRKRIWRSAGR-OH
Peptide Myr-RLYRKRIWRSAGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.hsBCL9CT-24
Blocks the Wnt pathway and inhibits the expression of TGFb1 in CT26 colon carcinoma cells, leading to the reduction of CCL20 and CCL22, two TGF-b- dependent chemokines critical for Treg cell recruitment into the tumour microenvironment. hsBCL9CT-24 shows robust antitumour efficacy across multiple in vivo models.
Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :1,629 g/molAc-Met-Ala-Ser-OH
CAS :Ac-Met-Ala-Ser-OH is a fine chemical that can be used as a building block in the synthesis of other compounds. It is also a reagent and speciality chemical, which are substances that are not typically found in everyday life but have specific uses. Ac-Met-Ala-Ser-OH is an intermediate chemical, meaning it is used to make something else, and can be used as a scaffold for developing new compounds. Ac-Met-Ala-Ser-OH has CAS number 149151-19-9.
Formule :C13H23N3O6SDegré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :349.4 g/molH-TLDPER^-OH
Peptide H-TLDPER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SDF-1α (human) trifluoroacetate salt
CAS :Please enquire for more information about SDF-1alpha (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormule :C356H578N106O93S4Degré de pureté :Min. 95%Masse moléculaire :7,959.32 g/molDSTYSLSSTLTLSK
CAS :Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormule :C64H107N15O26Masse moléculaire :1,616.64 g/molH-EFSEVEGR^-OH
Peptide H-EFSEVEGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TMLLQPAGSLGSYSYR^-OH
Peptide H-TMLLQPAGSLGSYSYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-Gly-Arg-Arg-AMC acetate salt
CAS :Boc-Gly-Arg-Arg-AMC acetate salt is a protease inhibitor that inhibits the activity of serine proteases. This protein is a potent and selective inhibitor of the NS3 protease from hepatitis C virus, which is responsible for the cleavage of polyproteins into mature proteins. Boc-Gly-Arg-Arg-AMC acetate salt has been shown to be effective in transfection experiments and polymerase chain reaction, as well as in inhibiting the activity of soybean trypsin and mammalian tissue proteases.
Formule :C29H44N10O7•(C2H4O2)xDegré de pureté :Min. 98 Area-%Couleur et forme :PowderMasse moléculaire :644.72 g/molAc-CPGADLGPECDSKRR-NH2
Peptide Ac-CPGADLGPECDSKRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Des-Acyl Ghrelin (Rat)
CAS :Des-Acyl Ghrelin (Rat) is a Des-Octanoylated Ghrelin product available in the Trifluoroacetate Salt form and as a 0.1mg vial. Ghrelin is a peptide horone which plays a role in regulating energy balance, stimulating appetite, nutrient sensing and meal initiation. It influences bodily functions through associating with growth hormone secretagogue receptors (GHS-R) through its unique N-octanoyl group which is linked to its serine 3 residue covalently. It wider functions are in the regulation of insulin resistance, diabetes and obesity. On top of this Ghrelin is also found to be involved with glucose homeostasis, energy homeostasis, cardio-protective effects, bone metabolism and is a potential target for cancer. Therefore it can be used to develop therapies for a whole spectrum of diseases. This molecule is used as a research tool for studying cell biology and pharmacology.Formule :C139H231N45O41Degré de pureté :Min. 95%Masse moléculaire :3,188.6 g/molProstaglandin A1
CAS :Please enquire for more information about Prostaglandin A1 including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formule :C20H32O4Degré de pureté :Min. 90 Area-%Masse moléculaire :336.47 g/molH-SAVTALWGK^-OH
Peptide H-SAVTALWGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Phe-Trp-OH
CAS :H-Phe-Trp-OH is an inhibitor of protein phosphatase 2A and is used in the diagnosis of kidney cancer. Magnetic resonance spectroscopy (MRS) is a technique that can be used to measure the concentration of phosphate groups in tissues. Hypophosphatemia, or low phosphate levels in the body, is associated with a number of diseases, including kidney cancer. This molecule inhibits the activity of phosphatase 2A and can be used as a diagnostic marker for such conditions. The enzyme has been shown to have an inhibitory effect on vitamin D3-induced synthesis of calcitriol (1,25-dihydroxyvitamin D3), which may be due to its ability to sequester phosphate groups. H-Phe-Trp-OH binds to proteins and has been shown to have an inhibitory effect on other enzymes such as histidine phosphatase and glutamine phosphatase.
Formule :C20H21N3O3Degré de pureté :Min. 95%Couleur et forme :PowderMasse moléculaire :351.4 g/molGurmarin
CAS :Gurmarin is a polycyclic diterpene that can be found in the bark of the G. lucidum tree. It has been shown to bind to glutamate receptors, which are ion channels that allow ions such as calcium and sodium to pass through cell membranes. Gurmarin has been shown to activate these receptors in vitro, and knockout or over-expression of these receptors in cells can lead to changes in receptor activity. Gurmarin has also been shown to have specific binding affinity for a certain type of receptor cell, which are cells with cation channels that may be involved in taste perception. The receptor binding site on the gurmarin molecule is thought to correspond with the sweet taste sensation.Formule :C187H276N46O53S6Degré de pureté :Min. 95%Masse moléculaire :4,208.95 g/molAc-TASSYFTNMFATWSPSKARL-NH2
Peptide Ac-TASSYFTNMFATWSPSKARL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.TentaGel® S NH2 Resin (130 um)
This resin is for use in combinatorial chemistry. TentaGel is a gelatinous resin and an important support for solid phase synthesis. TentaGel resins are constructed with a backbone of low crosslinked polystyrene grafted with polyoxyethylene (polyethylene glycol) as shown below. The typical chain length of POE (n) is approximately 68 ethylene oxide units or an average MW of 3000. This long chain creates a spacer that effectively separates the reactive site (X) from the crosslinked backbone matrix. Particle size 130 µm; capacity: 0.2-0.35 meq/g Substitution Functional Group: -O-CH2-CH2-NH2Degré de pureté :Min. 95%H-YPIKPEAPGEDASPEEL^NRYYASL^RHYL^NLVTRQRY-NH2
H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormule :C194H295N55O57Masse moléculaire :4,309.81 g/molH-DIVVLGVEK^-OH
Peptide H-DIVVLGVEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biotin-Substance P
Substance P (SP) is a peptide that is highly conserved across the animal kingdom and is involved in a number of inflammatory and growth promoting processes. SP has a net positive charge at physiological pH, it is an amphiphilic peptide with positively charged residues at the N-terminus and hydrophobic residues at the C-terminus, this controls how it interacts with cell membranes. SP is stable in plasma (several hours) but has a short half-life in tissues (seconds/minutes).SP is encoded by the TAC1 gene and is a member of the tachykinin peptide hormone family. SP is expressed by many cell types including: neurons, astrocytes, microglia, epithelial cells, endothelial cells, immune cells such as T cells and macrophages- dendritic cells and eosinophils and some stem cells and progenitor cells. The huge variety of cell types expressing SP suggest it is involved in a wide variety of physiological and pathophysiological functions.SP mediates its functions by interacting with members of the neurokinin (NK) family of G protein-coupled receptors with high selectivity. Among these, SP binds to NK1R with the highest affinity, this receptor is expressed in a wide range of tissue types.Biotin (B7) has been added to the N-terminus.Formule :C73H112N20O15S2Masse moléculaire :1,573.96 g/molH-GQPREPQVYTLPPSREEMTK^-OH
Peptide H-GQPREPQVYTLPPSREEMTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Lys-D-Trp-Phe-D-Trp-Leu-Leu-NH2
H-Lys-D-Trp-Phe-D-Trp-Leu-Leu-NH2 is a potent full inverse agonist for the Ghrelin Receptor. Ghrelin is a peptide hormone that stimulates GH release from the anterior pituitary gland. Ghrelin also has other functions in the body. It binds to the ghrelin receptor and increases appetite and gastric motility. Ghrelin can also stimulate insulin secretion from pancreatic beta cells. Ghrelin levels are high before meals and decrease after eating.
Formule :C49H66N10O6Degré de pureté :Min. 95%Masse moléculaire :891.14 g/molLCBiot-CVYKSPVVSGDTSPRH-OH
Peptide LCBiot-CVYKSPVVSGDTSPRH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Muscarinic Toxin 7
CAS :A synthetic snake toxin peptide sourced from Green Mamba, Dendroaspis angusticeps. This product is a specific ligand for Muscarinic Acetylcholine Receptor-1 (M1), has disulfide bonds between Cys3-Cys24, Cys17-Cys42, Cys46-Cys57, and Cys58-Cys63 and is available as a 0.1mg vial.Formule :C322H484N90O98S9Degré de pureté :Min. 95%Masse moléculaire :7,472.4 g/molH-VGLPISQ^R-OH
Peptide H-VGLPISQ^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 79
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Masse moléculaire :1,731.1 g/molCATH-2 (Chicken)
CATH-2 is a monoclonal antibody that inhibits the enterotoxin activity of E. coli, which is mediated by several strains of the bacteria. CATH-2 has been shown to be effective against enteritidis, an E. coli strain that causes food poisoning. It is not active against other strains of E. coli or Salmonella species and does not have any antibiotic effects. CATH-2 also has immunomodulatory effects and boosts chemokines such as MCP-3 and IL-8, which are chemokine receptors expressed in intestinal epithelial cells that may contribute to its anti-inflammatory properties.Formule :C147H245N51O30Degré de pureté :Min. 95%Masse moléculaire :3,206.92 g/molH-LQAEAFQ^AR-OH
Peptide H-LQAEAFQ^AR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.AF488 Maleimide
Please enquire for more information about AF488 Maleimide including the price, delivery time and more detailed product information at the technical inquiry form on this pageDegré de pureté :Min. 95%H-TYETTLEK^-OH
Peptide H-TYETTLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![Glucagon (1-29)-[Lys(AF647)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1101573.webp&w=3840&q=75)
