Prodotti biochimici e reagenti

The BIRC5 antibody is a monoclonal antibody that targets the growth factor known as neurotrophic factors. It acts as a neuroprotective agent by inhibiting the activity of phosphatase enzymes, which play a critical role in cell survival and growth. This antibody has shown promising results in studies involving sphingosine-induced neuronal death and pancreatic glucagon secretion. The BIRC5 antibody is produced using recombinant antigen technology and purified using cellulose-based chromatography methods. It can be used in various applications within the Life Sciences field, including research, diagnostics, and therapeutic development. This highly specific antibody is suitable for use in immunoassays, such as ELISA or Western blotting, to detect the presence of BIRC5 in samples such as blood plasma or tissue lysates. Its high affinity binding to BIRC5 makes it an ideal tool for studying cellular processes regulated by this growth factor.

Mouse monoclonal CTDSP1 antibody

The CAMKII antibody is a powerful tool in the field of Life Sciences. It is an essential component for various experiments and research studies. This antibody can be used in conjunction with electrodes to study the effects of different factors on cellular processes. The CAMKII antibody specifically targets and binds to proteins involved in cell signaling, such as epidermal growth factor and endothelial growth factor receptors.

A synthetic peptide for use as a blocking control in assays to test for specificity of RPL8 antibody, catalog no. 70R-1429

The JNK1 antibody is a highly specialized product used in Life Sciences research. It is designed to neutralize the activity of the growth factor, interleukin-6, in human serum. This antibody specifically targets and binds to the dimers of interleukin-6, preventing their interaction with cell receptors and inhibiting downstream signaling pathways.

PYGO1 antibody was raised in rabbit using the middle region of PYGO1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of COMMD1 antibody, catalog no. 70R-10355

A synthetic peptide for use as a blocking control in assays to test for specificity of MBD3 antibody, catalog no. 70R-2026

Affinity purified Rabbit polyclonal DMC1 antibody

Rabbit polyclonal ALPI antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of MXRA7 antibody, catalog no. 70R-6777

A synthetic peptide for use as a blocking control in assays to test for specificity of NR3C2 antibody, catalog no. 70R-1003

B3GALT1 antibody was raised using the C terminal of B3GALT1 corresponding to a region with amino acids YKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRVI

ICAM1 antibody was raised in rabbit using highly pure recombinant human ICAM-1 as the immunogen.

HAV VP1 antibody is a monoclonal antibody that specifically targets the HAV VP1 protein. This antibody can be used in various applications, including immunoassays and protein detection. The HAV VP1 antibody is highly specific and exhibits strong binding affinity to the target protein, ensuring accurate and reliable results.

Mouse monoclonal CD20 antibody (biotin)

Region of GDNF protein corresponding to amino acids MSPDKQAAAL PRRERNRQAA AASPENSRGK GRRGQRGKNR GCVLTAIHLN VTDLGLGYET KEELIFRYCS GSCESAETMY DKILKNLSRS RRLTSDKVGQ ACCRPVAFDD DLSFLDDNLV YHILRKHSAK RCGCI.

Ubiquilin 3 antibody was raised using the N terminal of UBQLN3 corresponding to a region with amino acids LMRQHVSVPEFVTQLIDDPFIPGLLSNTGLVRQLVLDNPHMQQLIQHNPE

POLK antibody was raised using a synthetic peptide corresponding to a region with amino acids ATECTLEKTDKDKFVKPLEMSHKKSFFDKKRSERKWSHQDTFKCEAVNKQ