Anticorpi primari

The SERPINF2 antibody is a highly effective neutralizing agent that has been extensively studied in various scientific fields, including Life Sciences. It is a monoclonal antibody that has shown promising results in inhibiting the activity of SERPINF2, a protein involved in adipose tissue regulation. Through electrochemical impedance spectroscopy, it has been demonstrated that this antibody effectively binds to SERPINF2 and prevents its interaction with other molecules in the reaction solution.

The B7H4 antibody is a monoclonal antibody that targets the B7H4 protein, which is expressed on the surface of tumor cells. This antibody has been shown to have potent anti-tumor activity and can effectively inhibit tumor growth. It works by blocking the interaction between B7H4 and its receptor, preventing the suppression of immune responses against tumor cells. In addition, the B7H4 antibody has been found to enhance the production of interferon-gamma (IFN-gamma) and interleukin-6 (IL-6), which are important cytokines involved in immune regulation. This antibody is highly specific for human B7H4 and does not cross-react with other proteins. It has been extensively tested in various preclinical models and has shown promising results in terms of efficacy and safety. The B7H4 antibody is a valuable tool for researchers in the field of Life Sciences who are studying tumor immunology and developing novel cancer therapies.

The TGF alpha antibody is a monoclonal antibody that specifically targets the growth factor known as transforming growth factor alpha (TGF alpha). TGF alpha is a glycoprotein that plays a crucial role in cell proliferation and differentiation. By binding to TGF alpha, this antibody inhibits its activity and prevents it from interacting with its receptor on the cell surface.

Affinity purified Rabbit polyclonal Proteasome 20S alpha 6 antibody

Rabbit polyclonal PIP5K3 antibody

PPCDC antibody was raised using the N terminal of PPCDC corresponding to a region with amino acids VTTERAKHFYSPQDIPVTLYSDADEWEIWKSRSDPVLHIDLRRWADLLLV

Affinity purified Rabbit polyclonal HLA DRB3 antibody

Caspase 1 antibody is a highly specific antibody that targets caspase 1, an enzyme involved in the inflammatory response. This antibody has been extensively tested and validated using human serum samples. It has been shown to effectively detect and quantify caspase 1 levels in various biological samples.

The CCR4 antibody is a highly specialized monoclonal antibody that has the unique ability to neutralize neurotrophic factors in the body. It specifically targets and inhibits the activity of TGF-β1, a key factor involved in cholinergic signaling. This antibody binds to specific receptor molecules on cells, preventing the activation of downstream signaling pathways and ultimately leading to a reduction in neurotrophic factor activity.

Mouse monoclonal CD11c antibody (allophycocyanin)

TAPBP antibody was raised using a synthetic peptide corresponding to a region with amino acids GEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHS

KRT18 antibody was raised in Rabbit using Human KRT18 as the immunogen

ABCA12 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLV

AKR1B10 antibody was raised using a synthetic peptide corresponding to a region with amino acids NEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDL

Rabbit polyclonal SHOC2 antibody

Bin1 antibody was raised in rabbit using the N terminal of Bin1 as the immunogen

Goat anti-human IgG/IgA/IgM (H+L) (Rhodamine) was raised in goat using human IgG, IgA and IgM whole molecules as the immunogen.

Rabbit polyclonal SAFB2 antibody