Anticorpi primari
Sottocategorie di "Anticorpi primari "
- Ricerca sul cancro Anticorpi(3.721 prodotti)
- Anticorpi cardiovascolari(2 prodotti)
- Biologia dello sviluppo(764 prodotti)
- Anticorpi epigenetici(162 prodotti)
- Anticorpi per l’immunologia(2.585 prodotti)
- Anticorpi metabolici(286 prodotti)
- Anticorpi per la microbiologia(741 prodotti)
- Trasduzione del segnale(2.765 prodotti)
- Tag e marcatori cellulari(34 prodotti)
Trovati 75594 prodotti di "Anticorpi primari "
PPP1R13B antibody
PPP1R13B antibody was raised using a synthetic peptide corresponding to a region with amino acids EFDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNAPurezza:Min. 95%Rat Thymocyte antibody
Rat thymocyte antibody was raised in rabbit using RBC-free rat thymocytes as the immunogen.
Purezza:Min. 95%TRIM33 antibody
The TRIM33 antibody is a monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to TRIM33 protein, which plays a crucial role in cellular processes. The antibody is made using advanced techniques and high-quality materials to ensure its effectiveness.
IFN gamma antibody
The IFN gamma antibody is a monoclonal antibody that targets interferon gamma, a cytokine involved in immune response regulation. This antibody specifically binds to interferon gamma and neutralizes its activity, making it an effective tool for research in the field of immunology. The IFN gamma antibody has been widely used in various life science applications, including ELISA, Western blotting, flow cytometry, and immunohistochemistry. It can be conjugated with different labels such as biotin or fluorescent dyes for detection purposes. Researchers rely on this antibody to study the role of interferon gamma in various diseases and to develop potential therapeutic strategies targeting this cytokine.
TS antibody
The TS antibody is an autoantibody that specifically targets glial fibrillary acidic protein (GFAP), a protein found in the central nervous system. It is commonly used in life sciences research to study the role of GFAP in various cellular processes. The TS antibody recognizes specific epitopes on GFAP and can be used for immunohistochemistry, immunocytochemistry, and Western blotting applications. This monoclonal antibody has high specificity and sensitivity, making it a valuable tool for studying GFAP expression and function. Additionally, the TS antibody can be conjugated with different fluorophores or enzymes for multiplexing experiments or detection purposes. Whether you're researching neurodegenerative diseases or investigating cellular responses to growth factors, the TS antibody is an essential reagent for your experiments. Trust its reliability and performance to deliver accurate and reproducible results in your scientific endeavors.
GAPDH antibody
The GAPDH antibody is a highly effective polyclonal antibody that is capable of neutralizing the activity of glyceraldehyde-3-phosphate dehydrogenase (GAPDH). This antibody has been extensively tested and shown to effectively inhibit the function of GAPDH in various experimental settings.
RAGE antibody
The RAGE antibody is a glycation-specific polyclonal antibody that targets the receptor for advanced glycation end products (RAGE). This antibody plays a crucial role in various pathological conditions, including thrombotic microangiopathy and atypical hemolytic uremic syndrome. It binds to RAGE and inhibits the interaction between RAGE and its ligands, such as advanced glycation end products (AGEs) and high mobility group box 1 (HMGB1). By blocking this interaction, the RAGE antibody can prevent the activation of downstream signaling pathways involved in inflammation and tissue damage. Additionally, this antibody has been used in research studies to investigate the role of RAGE in various diseases, including cancer and neurodegenerative disorders. The RAGE antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific experimental needs.
Purezza:Min. 95%PGAM1 antibody
The PGAM1 antibody is a highly versatile and potent tool used in various industries, including Life Sciences and industrial applications. This antibody exhibits antioxidant activity and has been shown to have an inhibitory effect on the growth factor. It can be immobilized for use in various assays, making it an essential component in molecular biology research.
WTAP antibody
The WTAP antibody is a highly specialized monoclonal antibody that has a wide range of applications in the field of Life Sciences. It acts as an inhibitory factor, blocking specific protein interactions and pathways. This antibody is produced using state-of-the-art technology and is free from any harmful excipients.
LGALS3BP antibody
The LGALS3BP antibody is a highly specialized monoclonal antibody that targets the fatty acid cyclase-activating protein (LGALS3BP). It is designed to specifically bind to LGALS3BP and neutralize its activity. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.
ZNF286 antibody
ZNF286 antibody was raised in rabbit using the C terminal of ZNF286 as the immunogenPurezza:Min. 95%ORM2 antibody
The ORM2 antibody is a highly specialized monoclonal antibody that is used in various applications within the field of life sciences. This antibody specifically targets and reacts with the ORM2 protein, which is found in blood plasma and plays a crucial role in transporting fatty acids. The ORM2 antibody can be used in assays such as double-label immunofluorescence to detect the presence and localization of ORM2 protein in different cell types or tissues. It has also been utilized in studies involving pluripotent stem cells, where it helps identify specific markers such as neuronspecific enolase. With its high specificity and affinity, the ORM2 antibody provides researchers with a valuable tool for investigating the functions and interactions of this important protein.
