Anticorpi primari
Sottocategorie di "Anticorpi primari "
- Ricerca sul cancro Anticorpi(3.721 prodotti)
- Anticorpi cardiovascolari(2 prodotti)
- Biologia dello sviluppo(764 prodotti)
- Anticorpi epigenetici(162 prodotti)
- Anticorpi per l’immunologia(2.585 prodotti)
- Anticorpi metabolici(286 prodotti)
- Anticorpi per la microbiologia(741 prodotti)
- Trasduzione del segnale(2.765 prodotti)
- Tag e marcatori cellulari(34 prodotti)
Trovati 75562 prodotti di "Anticorpi primari "
FAF1 antibody
FAF1 antibody is a monoclonal antibody that specifically targets Fas-associated factor 1 (FAF1), a protein found in the nucleus. This antibody has been extensively studied in Life Sciences research and has shown promising results in various assays. It has been shown to effectively bind to and immobilize FAF1, leading to the inhibition of its phosphatase activity. This makes FAF1 antibody a valuable tool for studying the role of FAF1 in cellular processes and signaling pathways.
Rabbit anti Guinea Pig IgG (H + L) (rhodamine)
Rabbit anti-guinea pig IgG (H+L) (Rhodamine) was raised in rabbit using guinea pig IgG whole molecule as the immunogen.
Purezza:Min. 95%PPP2R3A antibody
PPP2R3A antibody was raised using a synthetic peptide corresponding to a region with amino acids SSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTD
KLK6 antibody
KLK6 antibody was raised using the N terminal of KLK6 corresponding to a region with amino acids KHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQ
Caspase 6 antibody
The Caspase 6 antibody is a highly specialized affinity ligand that belongs to the class of polyclonal antibodies. It is specifically designed for the isolation and detection of retinal caspase 6, an important enzyme involved in programmed cell death. This antibody is commonly used in life sciences research, particularly in studies related to apoptosis and cell death pathways. It can be used as a powerful tool for investigating caspase 6 inhibitors, nuclear intermediates, and potential therapeutic medicines. The Caspase 6 antibody has been extensively tested and validated for its specificity and sensitivity, making it a reliable choice for researchers working with caspase 6-related studies. Whether you are conducting experiments or developing diagnostic tests, this antibody will provide accurate and reproducible results. With its high-quality formulation and solubilized format, it offers ease of use and convenience in various applications. Trust the Caspase 6 antibody to enhance your research capabilities and advance your scientific discoveries.
Creatine kinase antibody
The Creatine Kinase Antibody is an acidic antibody used in Life Sciences research. It is a monoclonal antibody that specifically targets the circumsporozoite protein, an antigen found in various organisms. This antibody has been widely used in studies related to growth factors, neuroprotection, and platelet-derived growth. It can be utilized in immunoassays, such as enzyme-linked immunosorbent assays (ELISA), western blotting, and immunohistochemistry. The Creatine Kinase Antibody offers high specificity and sensitivity, making it a valuable tool for researchers in the field. Whether you're studying cellular pathways or investigating disease mechanisms, this antibody will provide reliable results and contribute to advancements in scientific knowledge.
TRPC3 antibody
The TRPC3 antibody is a powerful tool for researchers in the field of Life Sciences. It specifically targets and binds to the epidermal growth factor, which is known to play a crucial role in various cellular processes. This antibody can be used to detect activated epidermal growth factor and has been extensively studied for its ability to inhibit protease activity.
RDX antibody
RDX antibody was raised using the middle region of RDX corresponding to a region with amino acids MSAPPPPPPPPVIPPTENEHDEHDENNAEASAELSNEGVMNHRSEEERVT
