Anticorpi primari
Sottocategorie di "Anticorpi primari "
- Ricerca sul cancro Anticorpi(3.721 prodotti)
- Anticorpi cardiovascolari(2 prodotti)
- Biologia dello sviluppo(764 prodotti)
- Anticorpi epigenetici(162 prodotti)
- Anticorpi per l’immunologia(2.585 prodotti)
- Anticorpi metabolici(286 prodotti)
- Anticorpi per la microbiologia(741 prodotti)
- Trasduzione del segnale(2.765 prodotti)
- Tag e marcatori cellulari(34 prodotti)
Trovati 75562 prodotti di "Anticorpi primari "
GSTT1 antibody
The GSTT1 antibody is a highly specific monoclonal antibody that targets the glutathione S-transferase theta 1 (GSTT1) protein. This antibody is commonly used in Life Sciences research to study the role of GSTT1 in various biological processes.
ICK antibody
The ICK antibody is a highly specialized antibody that targets the tyrosine kinase receptor, which plays a crucial role in growth factor signaling. This antibody is designed to specifically bind to the receptor and inhibit its activity, thereby blocking the downstream signaling pathways involved in cell growth and proliferation.
PPP2R3A antibody
PPP2R3A antibody was raised using a synthetic peptide corresponding to a region with amino acids SSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTD
SAE1 antibody
SAE1 antibody was raised using the N terminal of SAE1 corresponding to a region with amino acids MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAE
