Anticorpi primari
Sottocategorie di "Anticorpi primari "
- Ricerca sul cancro Anticorpi(3.721 prodotti)
- Anticorpi cardiovascolari(2 prodotti)
- Biologia dello sviluppo(764 prodotti)
- Anticorpi epigenetici(162 prodotti)
- Anticorpi per l’immunologia(2.585 prodotti)
- Anticorpi metabolici(286 prodotti)
- Anticorpi per la microbiologia(741 prodotti)
- Trasduzione del segnale(2.765 prodotti)
- Tag e marcatori cellulari(34 prodotti)
Trovati 75562 prodotti di "Anticorpi primari "
SLC25A29 antibody
SLC25A29 antibody was raised using the C terminal of SLC25A29 corresponding to a region with amino acids AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPA
DDT antibody
DDT antibody was raised using the N terminal of DDT corresponding to a region with amino acids PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALS
Tau antibody
The Tau antibody is a powerful tool in Life Sciences research. It is an antibody that specifically targets and binds to the protein Tau, which plays a crucial role in neurodegenerative diseases such as Alzheimer's disease. The antibody has been extensively studied and validated for its specificity and sensitivity.Purezza:Min. 95%AKR1C1 antibody
The AKR1C1 antibody is a potent family kinase inhibitor that targets specific growth factors, such as glucagon and epidermal growth factor. It is a polyclonal antibody that has been developed for neutralizing the effects of these growth factors in various biological systems. The antibody is formulated with excipients to ensure stability and efficacy. It can be used in various life science applications, including research and diagnostics. Additionally, the AKR1C1 antibody can also target other proteins, such as β-catenin, chemokines, alpha-fetoprotein, and globulins. Its specificity and effectiveness make it an essential tool for studying protein-protein interactions and cellular signaling pathways.
Purezza:Min. 95%GLIS3 antibody
GLIS3 antibody was raised in rabbit using the N terminal of GLIS3 as the immunogenPurezza:Min. 95%STC2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth, preventing transcription and replication. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Its active form undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed by Mycobacterium tuberculosis strains and inhibits cell growth in culture.
Rad9 antibody
Rad9 antibody is a monoclonal antibody that specifically binds to Rad9, a protein involved in DNA damage response and repair. This antibody has been shown to be highly effective in detecting Rad9 in various biological samples, including pleural fluid and human serum. It can be used for research purposes in the field of life sciences to study the role of Rad9 in cellular processes such as DNA repair, cell cycle regulation, and apoptosis. Additionally, Rad9 antibody has antiangiogenic properties and can inhibit endothelial growth by binding to specific receptors on endothelial cells. Its cytotoxic effects make it a promising candidate for targeted cancer therapy. With its high specificity and affinity for Rad9, this antibody is an invaluable tool for scientists studying biomolecules and their interactions.
Progesterone receptor antibody
The Progesterone receptor antibody is a highly specific monoclonal antibody that targets the progesterone receptor. It is designed to bind to the receptor and inhibit its activity, making it an essential tool for studying the role of progesterone in various biological processes.
