Anticorpi primari
Sottocategorie di "Anticorpi primari "
- Ricerca sul cancro Anticorpi(3.721 prodotti)
- Anticorpi cardiovascolari(2 prodotti)
- Biologia dello sviluppo(764 prodotti)
- Anticorpi epigenetici(162 prodotti)
- Anticorpi per l’immunologia(2.585 prodotti)
- Anticorpi metabolici(286 prodotti)
- Anticorpi per la microbiologia(741 prodotti)
- Trasduzione del segnale(2.765 prodotti)
- Tag e marcatori cellulari(34 prodotti)
Trovati 75562 prodotti di "Anticorpi primari "
HAVCR1 antibody
The HAVCR1 antibody is a polyclonal antibody that targets the protein known as HAVCR1. This antibody plays a crucial role in various biological processes, including caspase-9 activation, nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB) signaling pathway, β-catenin stabilization, and p38 mitogen-activated protein kinase (MAPK) activation.
FAM161A antibody
FAM161A antibody was raised in rabbit using the C terminal of FAM161A as the immunogen
DDIT4L antibody
DDIT4L antibody was raised using the middle region of DDIT4L corresponding to a region with amino acids KLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKL
ZNF660 antibody
ZNF660 antibody was raised in rabbit using the C terminal of ZNF660 as the immunogen
Purezza:Min. 95%CDK7 antibody
CDK7 antibody was raised in rabbit using the C terminal of CDK7 as the immunogen
Purezza:Min. 95%VPAC2 antibody
The VPAC2 antibody is a glycoprotein that acts as an endonuclease. It specifically targets and binds to the VPAC2 receptor, which is involved in various biological processes such as cell growth, differentiation, and immune response. This antibody is commonly used in life sciences research and has applications in fields such as immunology, cancer research, and drug development.
DKFZP761C169 antibody
DKFZP761C169 antibody was raised using the N terminal Of Dkfzp761C169 corresponding to a region with amino acids RKEKNGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIP
PLVAP antibody
The PLVAP antibody is a glycopeptide that belongs to the class of antibodies used in Life Sciences. It is specifically designed to target and bind to PLVAP (Plasmalemma Vesicle-Associated Protein), an important protein involved in various biological processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.
