Peptidi
Sottocategorie di "Peptidi"
Trovati 29780 prodotti di "Peptidi"
Fluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C41H43FN4O14Purezza:Min. 95%Peso molecolare:834.8 g/molLeucopyrokinin (LPK)
Catalogue peptide; min. 95% purity
Formula:C42H66N12O12Peso molecolare:931.06 g/molRef: 3D-VAC-00201
Prodotto fuori produzioneH-Asp-beta-Ala-OH
CAS:Please enquire for more information about H-Asp-beta-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C7H12N2O5Purezza:Min. 90 Area-%Colore e forma:PowderPeso molecolare:204.18 g/molRef: 3D-FA107994
Prodotto fuori produzioneMARCKS Protein (151-175)
Catalogue peptide; min. 95% purity
Formula:C147H243N41O31Peso molecolare:3,080.83 g/molRef: 3D-VAC-00526
Prodotto fuori produzionePKA Inhibitor Substrate
Catalogue peptide; min. 95% purity
Formula:C61H108N25O22PPeso molecolare:1,574.69 g/molRef: 3D-VAC-00448
Prodotto fuori produzioneDynorphin A (2-13), porcine
Catalogue peptide; min. 95% purity
Formula:C66H117N23O13Peso molecolare:1,440.81 g/molRef: 3D-VAC-00416
Prodotto fuori produzione[Trp11] Neurotensin (8-13)
Catalogue peptide; min. 95% purity
Formula:C40H65N13O7Peso molecolare:840.05 g/molRef: 3D-VAC-00688
Prodotto fuori produzioneα-Neo-Endorphin Analog
Catalogue peptide; min. 95% purity
Formula:C66H102N20O13Peso molecolare:1,383.68 g/molRef: 3D-VAC-00869
Prodotto fuori produzioneGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formula:C215H357N71O67SPeso molecolare:5,040.74 g/molRef: 3D-VAC-00849
Prodotto fuori produzioneAF-16 trifluoroacetate salt
CAS:AF-16 trifluoroacetate salt is a synthetic peptide, which is derived from chemical synthesis with tailored modifications to enhance its stability and efficacy. This compound acts by specifically binding to target receptors or proteins, facilitating the study of biochemical pathways and mechanisms at the molecular level. It is particularly used in biological and biochemical research settings to probe cellular processes, offering insights into protein interactions and signaling pathways.Formula:C71H119N25O25SPurezza:Min. 95%Peso molecolare:1,754.92 g/molRef: 3D-VAC-00353
Prodotto fuori produzioneNps-Val-OH·DCHA
CAS:Prodotto controllatoPlease enquire for more information about Nps-Val-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C11H14N2O4S·C12H23NPurezza:Min. 95%Peso molecolare:451.62 g/molRef: 3D-FN107891
Prodotto fuori produzioneRef: 3D-VAC-00727
Prodotto fuori produzioneADP-Ribosylation Factor 6, ARF6 (2-13)
Catalogue peptide; min. 95% purity
Formula:C60H102N16O17Peso molecolare:1,319.58 g/molRef: 3D-VAC-00433
Prodotto fuori produzioneC-Reactive Protein (CRP) (77-82)
Catalogue peptide; min. 95% purity
Formula:C23H40N6O10Peso molecolare:560.61 g/molRef: 3D-VAC-00793
Prodotto fuori produzione[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human
Catalogue peptide; min. 95% purity
Formula:C189H285N55O57SPeso molecolare:4,271.67 g/molRef: 3D-VAC-00911
Prodotto fuori produzionePACAP-27 (6-27) (human, chicken, mouse, ovine, porcine, rat)
CAS:Catalogue peptide; min. 95% purity
Formula:C121H193N33O30SPeso molecolare:2,638.15 g/molRef: 3D-VAC-00014
Prodotto fuori produzione[Ala5, beta-Ala8]-Neurokinin A (4-10)
Catalogue peptide; min. 95% purity
Formula:C35H56N8O9SPeso molecolare:765 g/molRef: 3D-VAC-00317
Prodotto fuori produzioneKGF Receptor Peptide
Catalogue peptide; min. 95% purity
Formula:C114H174N30O42SPeso molecolare:2,668.90 g/molRef: 3D-VAC-00491
Prodotto fuori produzioneNTB (Naltriben)
Catalogue peptide; min. 95% purity
Formula:C50H65N11O11S2Peso molecolare:1,060.29 g/molRef: 3D-VAC-00140
Prodotto fuori produzionebeta-Endorphin (27-31) (human)
Catalogue peptide; min. 95% purity
Formula:C28H45N7O9Peso molecolare:623.71 g/molRef: 3D-VAC-00890
Prodotto fuori produzioneRef: 3D-VAC-00256
Prodotto fuori produzioneRef: 3D-VAC-00032
Prodotto fuori produzioneBoc-D-His(Boc)-OH benzene solvate
CAS:Please enquire for more information about Boc-D-His(Boc)-OH benzene solvate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C16H25N3O6Purezza:Min. 95%Colore e forma:SolidPeso molecolare:355.39 g/molRef: 3D-FB111250
Prodotto fuori produzione[Ile12, Val15] MUC5AC Analog 3
Catalogue peptide; min. 95% purity
Formula:C67H112N16O25Peso molecolare:1,541.73 g/molRef: 3D-VAC-00456
Prodotto fuori produzioneCalcitonin N-Terminal Flanking Peptide, human
Catalogue peptide; min. 95% purity
Formula:C264H426N74O97SPeso molecolare:6,220.84 g/molRef: 3D-VAC-00238
Prodotto fuori produzioneBrain injury Derived Neurotrophic Peptide(3) BINP
Catalogue peptide; min. 95% purity
Formula:C62H101N17O19Peso molecolare:1,388.58 g/molDok-6 (263-275)
Catalogue peptide; min. 95% purity
Formula:C76H113N25O18Peso molecolare:1,664.90 g/molRef: 3D-VAC-00578
Prodotto fuori produzione(D-Ala2)-GRF (1-29) amide (human)
CAS:Please enquire for more information about (D-Ala2)-GRF (1-29) amide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C149H246N44O42SPurezza:Min. 95%Peso molecolare:3,357.88 g/molRef: 3D-FA109070
Prodotto fuori produzioneRef: 3D-VAC-00560
Prodotto fuori produzione[D-Ala2,Leu5,Arg6] Enkephalin
Catalogue peptide; min. 95% purity
Formula:C35H51N9O8Peso molecolare:725.85 g/molRef: 3D-VAC-00837
Prodotto fuori produzioneBCIP dipotassium
CAS:BCIP (5-bromo-4-chloro-3-indolyl phosphate) dipotassium is a chromogenic substrate commonly used for the detection of the enzymatic activity of alkaline phosphatase. Upon dephosphorylation by alkaline phosphatase, BCIP produces a blue precipitate, which can be easily visualized. This substrate has various uses, including the detection of gene expression in molecular biology, the identification of alkaline phosphatase activity in clinical pathology, and the detection of protein-protein interactions in biochemistry. Its long-term stability in solution makes it a common choice for many applications.
Formula:C8H4BrClK2NO4PPurezza:Min. 98 Area-%Colore e forma:PowderPeso molecolare:402.65 g/molRef: 3D-EB110885
Prodotto fuori produzioneSALMF amide 2 (S2)
Catalogue peptide; min. 95% purity
Formula:C59H82N14O18Peso molecolare:1,275.4 g/molRef: 3D-VAC-00720
Prodotto fuori produzioneBiotin-[Glu1]-Gastrin I (human) (phosphorylated)
Catalogue peptide; min. 95% purity
Formula:C107H141N22O37PS2Peso molecolare:2,422.53 g/molRef: 3D-VAC-00087
Prodotto fuori produzioneBiotinyl-MCH (salmon)
Catalogue peptide; min. 95% purity
Formula:C99H153N29O26S5Peso molecolare:2,325.82 g/molRef: 3D-VAC-00086
Prodotto fuori produzione[Pyr6]-Substance P (6-11)
Catalogue peptide; min. 95% purity
Formula:C36H49N7O7SPeso molecolare:723.91 g/molRef: 3D-VAC-00172
Prodotto fuori produzioneInfluenza HA (529-537)
Catalogue peptide; min. 95% purity
Formula:C41H67N9O13Peso molecolare:894.04 g/molRef: 3D-VAC-00515
Prodotto fuori produzione(D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH
CAS:Please enquire for more information about (D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C59H84N18O14Purezza:Min. 95%Peso molecolare:1,269.41 g/molRef: 3D-FS109491
Prodotto fuori produzioneBiotin-a-CGRP (canine, mouse, rat)
Catalogue peptide; min. 95% purity
Formula:C172H276N52O54S3Peso molecolare:4,032.63 g/molRef: 3D-VAC-00115
Prodotto fuori produzioneBiotin-[Tyr0]-Orexin B, mouse, rat
Catalogue peptide; min. 95% purity
Formula:C145H238N48O38S2Peso molecolare:3,325.86 g/molRef: 3D-VAC-00130
Prodotto fuori produzionebeta-Amyloid (7-22)
Catalogue peptide; min. 95% purity
Formula:C88H124N22O26Peso molecolare:2,466 g/molRef: 3D-VAC-00350
Prodotto fuori produzione[Met2]-Deltorphin
Catalogue peptide; min. 95% purity
Formula:C44H62N10O10S2Peso molecolare:955.17 g/molRef: 3D-VAC-00898
Prodotto fuori produzioneAc-Adhesin (1025-1044) amide
Catalogue peptide; min. 95% purity
Formula:C97H160N26O32Peso molecolare:2,202.51 g/molRef: 3D-VAC-00042
Prodotto fuori produzioneAmyloid Dan Protein (1-34)
Catalogue peptide; min. 95% purity
Formula:C185H268N48O51S2Peso molecolare:4,044.63 g/molRef: 3D-VAC-00166
Prodotto fuori produzioneMelanotan II, MT-Ⅱ
Catalogue peptide; min. 95% purity
Formula:C50H69N15O9Peso molecolare:1,024.2 g/molRef: 3D-VAC-00018
Prodotto fuori produzioneNES Topoisomerase II alpha (1017-1028)
Catalogue peptide; min. 95% purity
Formula:C73H117N19O19Peso molecolare:1,564.86 g/molRef: 3D-VAC-00329
Prodotto fuori produzione[Tyr8,Nle11] Substance P
Catalogue peptide; min. 95% purity
Formula:C64H100N18O14Peso molecolare:1,345.62 g/molRef: 3D-VAC-00677
Prodotto fuori produzioneRef: 3D-VAC-00670
Prodotto fuori produzioneRef: 3D-VAC-00171
Prodotto fuori produzioneInsulin Receptor (1142-1153)
Catalogue peptide; min. 95% purity
Formula:C72H107N19O24Peso molecolare:1,622.77 g/molRef: 3D-VAC-00774
Prodotto fuori produzione(Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt
CAS:Please enquire for more information about (Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C57H72N14O8Purezza:Min. 95%Peso molecolare:1,081.27 g/molBiotin-Bradykinin
Catalogue peptide; min. 95% purity
Formula:C60H87N17O13SPeso molecolare:1,286.53 g/molRef: 3D-VAC-00108
Prodotto fuori produzione[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat
Catalogue peptide; min. 95% purity
Formula:C157H253N53O42Peso molecolare:3,555.01 g/molRef: 3D-VAC-00488
Prodotto fuori produzioneTetanus toxin (TT) peptide
Catalogue peptide; min. 95% purity
Formula:C79H120N18O21Peso molecolare:1,657.95 g/molRef: 3D-VAC-00651
Prodotto fuori produzioneBig Gastrin-1, human
Catalogue peptide; min. 95% purity
Formula:C176H251N43O53SPeso molecolare:3,849.30 g/molRef: 3D-VAC-00188
Prodotto fuori produzioneKinase Domain of Insulin Receptor (5)
Catalogue peptide; min. 95% purity
Formula:C72H110N19O33Peso molecolare:1,862.77 g/molRef: 3D-VAC-00770
Prodotto fuori produzioneCorticostatin, human
Catalogue peptide; min. 95% purity
Formula:C157H261N49O43S6Peso molecolare:3,715.47 g/molRef: 3D-VAC-00788
Prodotto fuori produzioneDynorphin A (3-13), porcine
Catalogue peptide; min. 95% purity
Formula:C64H114N22O12Peso molecolare:1,383.76 g/molRef: 3D-VAC-00412
Prodotto fuori produzioneα-Melanocyte Stimulating Hormone, acetylated-[D-Val13] (11-13) (MSHa)
Catalogue peptide; min. 95% purity
Formula:C18H33N5O4Peso molecolare:383.49 g/molRef: 3D-VAC-00035
Prodotto fuori produzioneIL34 Human, His
IL34 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 260 amino acids (21-242 a.a) and having a molecular mass of 29.6kDa. IL34 is fused to a 38 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
Purezza:Min 85% By Sds-Page.Desmopressin
CAS:Prodotto controllatoDesmopressin is a synthetic analog of the natural hormone arginine vasopressin. It has been shown to be effective in the treatment of primary nocturnal enuresis, and a number of studies have reported that desmopressin is an effective therapy for idiopathic nocturnal enuresis. Desmopressin also has effects on water permeability, hemolysis, and protein synthesis. It increases the concentration of camp levels in urine and plasma while also inhibiting erythrocyte aggregation. Desmopressin has been shown to be more effective than placebo in women with primary nocturnal enuresis.Formula:C46H64N14O12S2Purezza:Min. 95%Colore e forma:PowderPeso molecolare:1,069.22 g/molH-D-Phe-pip-Arg-pna acetate
CAS:H-D-Phe-pip-Arg-pna acetate is an allosteric modulator that binds to the active site of thrombin. It inhibits activation of zymogen thrombin by binding to its receptor, thereby inhibiting clotting and coagulation. This compound has been shown to inhibit the activation of pyogenes by preventing the formation of fibrin clots, which are essential for bacterial growth. H-D-Phe-pip-Arg-pna acetate has also been shown to have an inhibitory effect on activated coagulation.
Formula:C27H36N8O5Purezza:Min. 95%Peso molecolare:552.6 g/molChorionic Gonadotropin-beta(109-119) amide (human)
Catalogue peptide; min. 95% purity
Formula:C51H76N16O21SPeso molecolare:1,269.31 g/molRef: 3D-VAC-00756
Prodotto fuori produzioneBoc-D-Glu-OEt·DCHA
CAS:Prodotto controllatoPlease enquire for more information about Boc-D-Glu-OEt·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C12H21NO6·C12H23NPurezza:Min. 95%Peso molecolare:456.62 g/molRef: 3D-FB111281
Prodotto fuori produzioneTGF α(34-43) (rat)
Catalogue peptide; min. 95% purity
Formula:C44H67N15O13S2Peso molecolare:1,078.25 g/molRef: 3D-VAC-00277
Prodotto fuori produzioneAngiotensin II type 1 receptor (181-187), AT1, ATE.
Catalogue peptide; min. 95% purity
Formula:C40H52N10O13Peso molecolare:880.92 g/molRef: 3D-VAC-00215
Prodotto fuori produzioneAKT/PKB/Rac-Protein Kinase Substrate
Catalogue peptide; min. 95% purity
Formula:C74H114N28O20Peso molecolare:1,715.91 g/molRef: 3D-VAC-00251
Prodotto fuori produzioneAbz-Val-Ala-Asp-Nva-Arg-Asp-Arg-Gln-EDDnp
CAS:Please enquire for more information about Abz-Val-Ala-Asp-Nva-Arg-Asp-Arg-Gln-EDDnp including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C53H80N20O18Purezza:Min. 95%Peso molecolare:1,285.3 g/mol[Ile161]MAGE-A2 (157-166)
Catalogue peptide; min. 95% purity
Formula:C59H91N11O15Peso molecolare:1,194.45 g/molRef: 3D-VAC-00894
Prodotto fuori produzioneP69 (522-534), M. leprae
Catalogue peptide; min. 95% purity
Formula:C52H84N14O21Peso molecolare:1,241.33 g/molRef: 3D-VAC-00624
Prodotto fuori produzione[Ala4]-MBP (1-11)
Catalogue peptide; min. 95% purity
Formula:C49H81N21O17Peso molecolare:1,236.32 g/molRef: 3D-VAC-00021
Prodotto fuori produzioneAlpha-Dendrotoxin
CAS:Alpha-dendrotoxin is a type of neurotoxin that blocks the voltage-gated sodium channel, which provides the neuron with a steady supply of energy. This toxin is found in the venom of certain snakes and can cause paralysis and death. Alpha-dendrotoxin binds to site 1 on the voltage-gated sodium channel and prevents it from opening. It does this by binding to its receptor, which is located on the inside surface of the cell membrane, thus blocking other ions from entering or leaving the cell. The blockage of ions leads to neuronal function impairment, such as memory loss or muscle paralysis.
Formula:C305H472N98O84S6Purezza:Min. 95 Area-%Colore e forma:PowderPeso molecolare:7,048.02 g/molCJC-1295
CAS:CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.
Purezza:Min. 95%Ketolide resistance Peptide MRFFV
Catalogue peptide; min. 95% purity
Formula:C34H50N8O6SPeso molecolare:698.9 g/molRef: 3D-VAC-00610
Prodotto fuori produzioneBiotin-Neuromedin S (rat)
Catalogue peptide; min. 95% purity
Formula:C67H87N15O14Peso molecolare:1,326.53 g/molRef: 3D-VAC-00102
Prodotto fuori produzioneAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formula:C40H62N12O9•(C2HF3O2)xPurezza:Min. 95%Colore e forma:PowderPeso molecolare:855 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C48H76N12O13SPeso molecolare:1,079.27 g/molRef: 3D-PP42775
Prodotto fuori produzioneCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C69H113N23O23•(C2HF3O2)4Purezza:Min. 95%Peso molecolare:2,088.86 g/molH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formula:C49H75N9O11Peso molecolare:966.18 g/molRef: 3D-PP48052
Prodotto fuori produzioneCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C65H110N10O16Purezza:Min. 95%Peso molecolare:1,287.65 g/mol
![[Trp11] Neurotensin (8-13)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00688.webp&w=3840&q=75)
![[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00911.webp&w=3840&q=75)
![[Ala5, beta-Ala8]-Neurokinin A (4-10)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00317.webp&w=3840&q=75)
![[Ile12, Val15] MUC5AC Analog 3](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00456.webp&w=3840&q=75)
![[D-Ala2,Leu5,Arg6] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00837.webp&w=3840&q=75)
![Biotin-[Glu1]-Gastrin I (human) (phosphorylated)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00087.webp&w=3840&q=75)
![[Pyr6]-Substance P (6-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00172.webp&w=3840&q=75)
![Biotin-[Tyr0]-Orexin B, mouse, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00130.webp&w=3840&q=75)
![[Met2]-Deltorphin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00898.webp&w=3840&q=75)
![[Tyr8,Nle11] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00677.webp&w=3840&q=75)
![[Glu2]-TRH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00171.webp&w=3840&q=75)
![[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00488.webp&w=3840&q=75)
![α-Melanocyte Stimulating Hormone, acetylated-[D-Val13] (11-13) (MSHa)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00035.webp&w=3840&q=75)
![[Ile161]MAGE-A2 (157-166)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00894.webp&w=3840&q=75)
![[Ala4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00021.webp&w=3840&q=75)
