Peptidi
I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.
Sottocategorie di "Peptidi"
Trovati 29608 prodotti di "Peptidi"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
GRGDSPC
CAS:GRGDSPC: 7-AA thiolated peptide; non-viral gene vector; easy synthesis; high efficiency; low toxicity.Formula:C25H42N10O11SPurezza:98%Colore e forma:SolidPeso molecolare:690.73P110
CAS:Drp1 inhibitor blocks its GTPase, preserves mitochondrial function, and reduces ROS and cell death, aiding Parkinson's model.Formula:C100H179N45O25Purezza:98%Colore e forma:SolidPeso molecolare:2411.8TNF-α (10-36), human (TFA) (144796-70-3 free base)
TNF-α (10-36), human (TFA) is a peptide of human TNF-α.Formula:C133H212N43O40Purezza:98%Colore e forma:SolidPeso molecolare:3110.36ProTx III
Potent Nav1.7 inhibitor (IC50=2.5nM); blocks Nav1.1/1.2/1.3/1.6; no Cav/nAChR impact at 5μM; analgesic; counters scorpion toxin OD1.Formula:C162H246N52O43S6Purezza:98%Colore e forma:SolidPeso molecolare:3802.41Super-TDU (TFA) (1599441-71-0 free base)
uper-TDU is an inhibitory peptide targeting YAP-TEADs interaction.Formula:C239H371N66O71SPurezza:98%Colore e forma:SolidPeso molecolare:5393.96Apraglutide TFA (1295353-98-8 free base)
Apraglutide TFA is a synthetic 33-amino acid, long-acting GLP-2 analog that promotes intestine growth in short bowel syndrome.Formula:C172H263N43O52·C2HF3O2Purezza:98%Colore e forma:SolidPeso molecolare:3879.27Agavoside C
CAS:Agavoside C is a biochemical.Formula:C50H80O23Purezza:98%Colore e forma:SolidPeso molecolare:1049.167F-Chemotactic peptide-fluorescein
CAS:F-Chemotactic peptide-fluorescein is a fluorescent label.Formula:C64H76N8O14SPurezza:98%Colore e forma:SolidPeso molecolare:1213.41Bacterial Sortase Substrate III, Abz/DNP (TFA)
Abz/DNP TFA is a quenched fluorescent peptide, cleaved by SrtA in Staphylococcus aureus, forming amide bonds in cell walls.
Formula:C43H58N11F3O16Purezza:98%Colore e forma:SolidPeso molecolare:1042.02VV-Hemorphin-7
CAS:VV-Hemorphin-7 is a morphinomimetic peptide.Formula:C59H82N14O13Purezza:98%Colore e forma:SolidPeso molecolare:1195.37[SER140]-PLP(139-151)
CAS:[SER140]-PLP(139-151) is a polypeptide fragment of the lipid protein of myelin.Formula:C72H104N20O17Purezza:98%Colore e forma:SolidPeso molecolare:1521.72Pseudo RACK1
Protein kinase C activator linked to Antennapedia domain for cell entry; ensures quick uptake and intracellular release.Formula:C144H225N43O34S3Purezza:98%Colore e forma:SolidPeso molecolare:3198.815-CR110 [5-Carboxyrhodamine 110] *Single isomer*
CR110 reagents are more photostable and pH-independent than FITC/FAM, with optimal absorption at 488 nm.Formula:C21H15N2O5ClPurezza:98%Colore e forma:SolidPeso molecolare:410.81Latromotide
CAS:Latromotide is an antineoplastic agent.Formula:C60H105N17O12Purezza:98%Colore e forma:SolidPeso molecolare:1256.58Rink Amide MBHA resin (100 - 200 mesh); loading 0.54 mmol/g
CAS:Colore e forma:White to light-yellow or beige beadsPeso molecolare:-OVA G4 peptide
CAS:G4 peptide (SIIGFEKL), a variant of ovalbumin epitope SIINFEKL, binds to mouse MHC class I H-2Kb.Formula:C43H71N9O12Purezza:98%Colore e forma:SolidPeso molecolare:906.08κM-Conotoxin RIIIK
CAS:κM-Conotoxin RIIIK is a potassium channel antagonist that inhibits voltage-activated potassium ion channels [1].Formula:C106H178N34O33S6Purezza:98%Colore e forma:SolidPeso molecolare:2649.15Orexin B, human TFA (205640-91-1 free base)
Orexin B, human (TFA) is an endogenous agonist at Orexin receptor with Kis of 420 and 36 nM for OX1 and OX2.
Formula:C123H212N44O35S·C2HF3O2Purezza:98%Colore e forma:SolidPeso molecolare:3013.36OVA sequence (323-336)
CAS:This peptide is a cognate helper T-lymphocyte peptide that is employed to enhance CTL epitope immunogencityFormula:C63H100N20O22Purezza:98%Colore e forma:SolidPeso molecolare:1489.59RGD peptide (GRGDNP) (TFA) (114681-65-1 free base)
RGD peptide (GRGDNP) (TFA) promote apoptosis through activation of conformation changes that enhance pro-caspase-3 activation and autoprocessing.Formula:C25H39F3N10O12Purezza:98%Colore e forma:SolidPeso molecolare:728.63TATU
CAS:Formula:C10H15N6OBF4Purezza:≥ 99.0%Colore e forma:White to off-white crystalline powderPeso molecolare:322.07Bio-Ben
Bio-ben functions as a sulfenic acid probe, utilized for labeling both free sulfenic acid and cysteine sulfenic acid within proteins and peptides.Formula:C17H22BN3O4SColore e forma:SolidPeso molecolare:375.20Calcitonin, eel TFA (57014-02-5 free base)
Calcitonin,eel TFA is a thyroid hormone polypeptide that can regulate calcium homeostasis and is widely used in the study of postmenopausal osteoporosis.Formula:C148H242F3N43O49S2Purezza:98%Colore e forma:SolidPeso molecolare:3528.89Palmitoyl dipeptide-7
CAS:Palmitoyl dipeptide-7 is a peptide.Formula:C26H51N3O5Purezza:98%Colore e forma:SolidPeso molecolare:485.7Uty HY Peptide (246-254)
CAS:Uty HY Peptide (246-254) is a male-specific antigen from Y chromosome H-YDB gene.Formula:C53H77N15O13S2Purezza:98%Colore e forma:SolidPeso molecolare:1196.4EGFR Peptide (human, mouse) TFA
EGFR peptide, a PKC peptide substrate, mirrors an amino acid sequence from EGFR's intracellular region and serves to gauge PKC activity in primary bovineFormula:C46H91N21O10·XCF3COOHColore e forma:SolidPeso molecolare:1098.35Dynorphin A (1-10) TFA(79994-24-4,free)
Dynorphin A (1-10) (TFA), an endogenous opioid neuropeptide, binds in the transmembrane domain of the κ-receptor.Formula:C59H92F3N19O14Purezza:98%Colore e forma:SolidPeso molecolare:1348.48Sdrnflrfamide
CAS:Sdrnflrfamide exhibits FMRFamide-like immunoreactivity isolated from the nervous system of the lobster Homarus americanus.Formula:C47H72N16O12Purezza:98%Colore e forma:SolidPeso molecolare:1053.17Super Fluor 750, SE
Super Fluor 750, SE: a dye for labeling antibodies, proteins, tracers, optimized for cell detection.Purezza:98%Colore e forma:SolidDifopein TFA (396834-58-5 free base)
Difopein (TFA) is a 14-3-3 protein inhibitor that induces apoptosis and boosts cisplatin efficacy.Formula:C275H425N76F3O91S6Purezza:98%Colore e forma:SolidPeso molecolare:6501.19Asp-Asp-Asp-Asp-Asp
CAS:Asp-Asp-Asp-Asp-Asp is a peptide consists of 5 Asp.Formula:C20H27N5O16Purezza:98%Colore e forma:SolidPeso molecolare:593.45Competence-Stimulating Peptide-12261
CAS:Competence-Stimulating Peptide-12261, a sixteen peptide, is a fragment of competence-stimulating peptide.Formula:C100H149N31O23Purezza:98%Colore e forma:SolidPeso molecolare:2153.45Super Fluor 555
Super Fluor 555 dye attaches to proteins for bright, stable, sensitive detection of biological structures.
Purezza:98%Colore e forma:SolidPeso molecolare:N/ARecanaclotide
CAS:Recanaclotide can be used to treat Gastroparesis, Functional Dyspepsia, and Other Gastrointestinal Disorders.Formula:C45H71N14O20PS6Purezza:98%Colore e forma:SolidPeso molecolare:1351.49BDC2.5 mimotope 1040-51
CAS:BDC2.5 mimotope 1040-51 is an agonistic peptide for T cells in diabetic NOD mice.Formula:C60H99N17O13SPurezza:98%Colore e forma:SolidPeso molecolare:1298.6M-2420
CAS:M-2420 is a fluorogenic substrate designed specifically for the β-secretase site found in the Swedish mutation of the amyloid precursor protein (APP).Formula:C70H91N15O27Purezza:98%Colore e forma:SolidPeso molecolare:1574.56LF 11 acetate
LF 11 acetate exhibits antibacterial activities and can be used for the development of endotoxin-neutralizing and antibacterial agents.
Formula:C71H116N26O16Purezza:98.85%Colore e forma:SolidPeso molecolare:1589.85Thioredoxin reductase peptide TFA
Thioredoxin reductase peptide TFA corresponds to residues 53-67 in thioredoxin reductase (TrxR), used in thioredoxin reductase research..Formula:C68H107F3N18O20S2Purezza:98%Colore e forma:SolidPeso molecolare:1617.81coagulation factor II (thrombin) B chain fragment [Homo sapiens]
Thrombin, a serine protease from the F2 gene, activates clotting by converting fibrinogen to fibrin.Formula:C90H137N23O24SPurezza:98%Colore e forma:SolidPeso molecolare:1957.26AF1 Neuropeptide
CAS:AF1 Neuropeptide, known as a sequenced bioactive neuropeptide, was seperated from the nematode Ascaris suum.Formula:C45H69N13O10Purezza:98%Colore e forma:SolidPeso molecolare:952.11Somatostatin-28 (1-12)
CAS:Somatostatin-28 (1-12) is a somatostatin fragment which is monitored in brain tissue to track processing of somatostatin.Formula:C49H81N17O19SPurezza:98%Colore e forma:SolidPeso molecolare:1244.33Adrenomedullin (AM) (1-52), human
CAS:Adrenomedullin (AM) (1-52), human is a 52-amino acid peptide that modulates cellular proliferation and angiogenesis in cancer.Formula:C264H406N80O77S3Purezza:98%Colore e forma:SolidPeso molecolare:6028.82AMARA peptide TFA (163560-19-8 free base)
AMARA peptide (TFA) is a substrate for salt-induced kinase (SIK) and adenosine activated protein kinase (AMPK).Formula:C64H116F3N27O18SPurezza:98%Colore e forma:SolidPeso molecolare:1640.84Exendin-4 peptide derivative
Exendin-4 derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS linked to GLP-1/glucagon agonism.Purezza:98%Colore e forma:SolidPeso molecolare:3692.15CGRP(83-119), rat
Calcitonin Gene Related Peptide (CGRP) (83-119), rat is a 37 amino acid calcitonin family of neuropeptide, acts through calcitonin receptor-like receptor.Formula:C162H262N50O52S2Purezza:98%Colore e forma:SolidPeso molecolare:3806.3β-Casomorphin (1-3), amide
CAS:β-Casomorphin (1-3), amide is a peptide fragment of β-Casomorphin with 3 amino acid.Formula:C23H28N4O4Purezza:98%Colore e forma:SolidPeso molecolare:424.49TBTU
CAS:Formula:C11H16BF4N5OPurezza:≥ 99.0%Colore e forma:White to almost white powderPeso molecolare:321.08Cucumechinoside D
CAS:Cucumechinoside D is a natural bioactive chemical.Formula:C54H84O32S3Purezza:98%Colore e forma:SolidPeso molecolare:1341.41QL9
CAS:QL9 is derived from the enzyme 2-oxoglutarate dehydrogenase and belongs to the endogenous peptide repertoire of all H-2d APCs.Formula:C52H74N10O14Purezza:98%Colore e forma:SolidPeso molecolare:1063.21Sperm acrosomal peptide P23
CAS:Sperm acrosomal peptide P23 is a peptide obtained from sperm acrosomal protein.Formula:C31H59N9O7Purezza:98%Colore e forma:SolidPeso molecolare:669.86SPR741 TFA (1179330-52-9 free base)
SPR741 TFA (NAB741 TFA) is a cationic peptide derived from polymyxin B and is a potentiator molecule.Formula:C46H74F3N13O15Purezza:98%Colore e forma:SolidPeso molecolare:1106.15Nuclear pore complex protein Nup98 315-360
Nuclear pore complex protein Nup98 (315-360) is the 315-360 fragment part of the nuclear pore complex (NPC) protein.
Formula:C190H288N50O64SPurezza:98%Colore e forma:SolidPeso molecolare:4328.68Pfaffoside B
CAS:Pfaffoside B is a nortriterpenoid saponin.Formula:C68H110O33Purezza:98%Colore e forma:SolidPeso molecolare:1455.595Margatoxin TFA
Margatoxin TFA, an alpha-KTx scorpion toxin isolated from Centruroides margaritatus venom, is a 39-amino-acid peptide that serves as a high-affinity inhibitorFormula:C178H286N52O50S7·xC2HF3O2Purezza:98%Colore e forma:SolidPeso molecolare:4178.95 (free base)APTSTAT3-9R acetate
APTSTAT3-9R acetate is a selective peptide binding STAT3 with antiproliferative and antitumor activity.Formula:C225H334N80O53Purezza:98%Colore e forma:SolidPeso molecolare:5007.56Lpigppal
CAS:Lysyl-prolyl-isoleucyl-glutamyl-phenylalanyl-4-nitrophenylalanyl-arginyl-leucine is a bioactive chemical.Formula:C52H79N13O13Purezza:98%Colore e forma:SolidPeso molecolare:1094.26GLGPNPCRKKCYKRDFLGR
GLGPNPCRKKCYKRDFLGR is a synthetic peptide.Formula:C96H158N32O24S2Purezza:98%Colore e forma:SolidPeso molecolare:2208.64Biotin-Crosstide TFA
Biotin-crosstide is a derivative of the peptide Akt substrate crosstide, featuring biotinylation.Formula:C58H91N19O19S·XCF3COOHColore e forma:SolidPeso molecolare:1390.53DT-2 acetate
DT-2 acetate, a selective cGMP-dependent protein kinase (PKG) inhibitor, is a mouse monoclonal antibody targeting canine thymocytes.DT-2 acetate inhibits PKG-catalyzed phosphorylation, reverses 8-Br-cGMP-induced expansion, and can be used to study immune disorders.Formula:C124H227N53O25Purezza:99.80%Colore e forma:SolidPeso molecolare:2860.47FMRF
CAS:FMRF is a peptide consisting of 4 amino acid residues.Formula:C29H41N7O5SPurezza:98%Colore e forma:SolidPeso molecolare:599.74ω-Conotoxin CVIA
CAS:ω-Conotoxin CVIA, a 27-amino acid neuropeptide, functions as a blocker of voltage-sensitive calcium channels (VSCCs) [1].Formula:C97H161N39O36S6Purezza:98%Colore e forma:SolidPeso molecolare:2641.95BDNF (human)
CAS:BDNF, a neurotrophin, activates TrkB/p75 receptors, aids neuron survival and growth, and is linked to Parkinson's and Alzheimer's.
Purezza:98%Colore e forma:SolidPeso molecolare:26984Preprosomatostatin (25-34)
CAS:Preprosomatostatin (25-34) is a peptide.Formula:C52H83N17O15Purezza:98%Colore e forma:SolidPeso molecolare:1186.32Conopressin S
CAS:Conopressin S, isolated from Conus striatus, shows high affinity with vasopressin V1b receptor (AVPR1B), with a Ki of 8.3 nM.Formula:C41H73N17O10S2Purezza:98%Colore e forma:SolidPeso molecolare:1028.26Biotin-SRC-1 (676-700) TFA
Biotin-SRC-1 (676–700), a biotinylated and truncated variant of steroid receptor coactivator 1 (SRC-1), finds application in affinity-based reporter assays suchFormula:C128H209N41O40S2·XCF3COOHColore e forma:SolidPeso molecolare:3026.41Ethyl (hydroxyimino)cyanoacetate
CAS:Formula:C5H6N2O3Purezza:≥ 98.0%Colore e forma:White to pale yellow crystals or crystalline powderPeso molecolare:142.11CEP dipeptide 1
CAS:CEP dipeptide 1 stimulates angiogenesis, playing a key role in age-related macular degeneration (AMD).Formula:C18H27N3O6Purezza:98%Colore e forma:SolidPeso molecolare:381.42ATI-2341 TFA (1337878-62-2 free base)
ATI-2341 is a CXCR4 allosteric agonist, promoting Gi activation, inhibiting cAMP, mobilizing PMNs and HSPCs.Formula:C106H179F3N26O27S2Purezza:98%Colore e forma:SolidPeso molecolare:2370.84Alisporivir intermediate-1
CAS:Alisporivir intermediate-1: Key for synthesizing Alisporivir, used against inflammation and viruses.
Formula:C74H132N12O17Purezza:98%Colore e forma:SolidPeso molecolare:1461.91GpTx-1
CAS:GpTx-1 exhibits potent selectivity as a NaV1.7 antagonist, demonstrating an inhibition concentration (IC50) of 10 nM [1].Formula:C176H271N53O45S7Purezza:98%Colore e forma:SolidPeso molecolare:4073.82Tyr-Somatostatin-14
CAS:Tyr-Somatostatin-14 is a modified peptide incorporating an additional Tyrosine (amino acid) into the structure of Somatostatin-14.Formula:C85H113N19O21S2Purezza:98%Colore e forma:SolidPeso molecolare:1801.05Super Fluor 647, SE
Super Fluor 647, SE labels proteins and peptides for bright cellular detection without self-quenching.Purezza:98%Colore e forma:SolidPeso molecolare:N/AC3a (70-77) TFA (63555-63-5 free base)
C3a (70-77) TFA (Complement 3a (70-77) TFA) is a COOH-terminal fragment of the C3a anaphylatoxin peptide.Formula:C37H62F3N13O12Purezza:98%Colore e forma:SolidPeso molecolare:937.96Interphotoreceptor retinoid-binding protein(668-687)
CAS:Interphotoreceptor retinoid-binding protein(668-687)is an amino acid residue of human retinoid-binding protein(IRBP) 668-687, which can induce uveitis.Formula:C91H151N25O32Purezza:98%Colore e forma:SolidPeso molecolare:2107.32LAH4 acetate
LAH4 acetate is the α-helical structure of the designed amphoteric peptide antibiotic, which is capable of complexing DNA, associating with the cell surface
Formula:C134H232N38O29Purezza:98.41%Colore e forma:SoildPeso molecolare:2839.51Dusquetide aceate
Dusquetide acetate: innate immune modulator with anti-inflammatory and antibacterial properties.
Formula:C27H51N9O7Purezza:97.33%Colore e forma:SolidPeso molecolare:613.75Laminin (925-933)(TFA) (110590-60-8 free base)
Laminin (925-933) (TFA) is a peptide derived from residues 925-933 of the Laminin B1 chain that binds to the laminin receptor.Formula:C42H63F3N12O16SPurezza:98%Colore e forma:SolidPeso molecolare:1081.08[Arg8]-Vasotocin TFA (113-80-4 free base)
[Arg8]-Vasotocin (TFA) is a nonmammalian vertebrate neurohypophyseal peptide.Formula:C45H68F3N15O14S2Purezza:98%Colore e forma:SolidPeso molecolare:1164.24SV40 large T antigen NLS
SV40 Large T antigen NLS, residues 47-55, facilitates nuclear import of proteins.Formula:C58H104N20O18SPurezza:98%Colore e forma:SolidPeso molecolare:1401.7GIP (1-30) amide (Human) (TFA)
GIP (1-30) amide (Human) TFA: Incretin hormone fragment that boosts insulin secretion and lowers post-meal blood sugar.Formula:C164H241F3N40O49SPurezza:98%Colore e forma:SolidPeso molecolare:3645.97Lagatide
CAS:Lagatide is a synthetic heptapeptide that has antisecretory activity.Formula:C33H58N10O9Purezza:98%Colore e forma:SolidPeso molecolare:738.88GrTx1
GrTx1, a peptide toxin derived from Grammostola rosea spider venom, selectively inhibits sodium channels Nav1.1, Nav1.2, Nav1.3, Nav1.4, Nav1.6, and Nav1.7,Formula:C159H243N45O41S8Purezza:98%Colore e forma:SolidPeso molecolare:3697.43CysHHC10 TFA(1408311-03-4 free base)
CysHHC10 TFA is a synthetic antimicrobial peptide (AMP), and exhibits strong anti-microbial properties against both Gram-positive and Gram-negative bacteria.Formula:C79H108F3N23O12SPurezza:98%Colore e forma:SolidPeso molecolare:1660.91β-Secretase inhibitor-STA
CAS:BACE-IN-1 is amyloid precursor protein beta-secretase inhibitor
Formula:C73H118N16O27Purezza:98%Colore e forma:SolidPeso molecolare:1651.81MAGE-A3 (195-203)
CAS:MAGE-3/HLA-A24 is a strong MHC-binding peptide, promising for immunotherapy in MAGE-3+ tumors.Formula:C45H82N10O10SPurezza:98%Colore e forma:SolidPeso molecolare:955.3p2Ca
CAS:p2Ca, peptide from alpha-ketoglutarate dehydrogenase, pairs with MHC-I protein Ld, recognized by CTL clone 2C.Formula:C47H66N8O12Purezza:98%Colore e forma:SolidPeso molecolare:935.07Cholecystokinin pentapeptide
CAS:Cholecystokinin pentapeptide is a peptide hormone of the gastrointestinal system responsible for stimulating the digestion of fat and protein.Formula:C31H39N7O7SPurezza:98%Colore e forma:SolidPeso molecolare:653.75Small cardioactive peptide A
CAS:Small cardioactive peptide A modulates neuromuscular connections and feeding behavior in molluscs as a cotransmitter.Formula:C59H92N18O12SPurezza:98%Colore e forma:SolidPeso molecolare:1277.54Sperm-activating peptide 1
CAS:Sperm-activating peptide 1 is a bioactive chemical.Formula:C44H71N11O12S2Purezza:98%Colore e forma:SolidPeso molecolare:1010.23Allatostatin II
CAS:Allatostatin II is an Inhibitors of juvenile hormone synthesis in insects.
Formula:C49H74N14O13Purezza:98%Colore e forma:SolidPeso molecolare:1067.2Proadrenomedullin (45-92), human
CAS:Proadrenomedullin (45-92), human, a mid-regional fragment of proadrenomedullin (MR-proADM), comprises amino acids 45–92 of pre-proADM.Formula:C215H359N67O73S2Purezza:98%Colore e forma:SolidPeso molecolare:5114.76cAC 253
Amylin antagonist AMY3, IC50 0.3 μM, shields neurons from Aβ toxicity, brain-penetrant, boosts memory, lowers Aβ plaques in Alzheimer's mice.Formula:C126H202N42O40S2Purezza:98%Colore e forma:SolidPeso molecolare:3009.36Nifalatide
CAS:Nifalatide is a analog of enkephalin.Formula:C30H39N7O9SPurezza:98%Colore e forma:SolidPeso molecolare:673.74Super-TDU (1-31) TFA
Super-tdu (1-31) TFA is an endogenous ligand of heptapeptide receptor and has a strong anti-analgesic effect.
Formula:C141H218N40O48·C2HF3O2Purezza:98%Colore e forma:SolidPeso molecolare:3355.5Ziptide TFA
Ziptide, a peptide substrate, is recognized by several serine/threonine protein kinases, such as MAPK activated protein kinase 2 (MAPKAPK2), MAPKAPK3, MAPKAPK5Formula:C65H109N19O19·XCF3COOHColore e forma:SolidPeso molecolare:1460.70Thioctoyl tripeptide-1
CAS:Thioctoyl tripeptide-1 is a peptide.
Formula:C22H36N6O5S2Purezza:98%Colore e forma:SolidPeso molecolare:528.69NEP(1-40)
CAS:Nogo-66 (1–40) peptide blocks NgR, enhances axonal growth, and aids spinal recovery, but doesn't affect MAG inhibition.Formula:C206H324N56O65Purezza:98%Colore e forma:SolidPeso molecolare:4625.16SP-346 nonapeptide
CAS:SP-346 nonapeptide is a pipecolic acid substituted nonapeptide.Formula:C48H77N13O14Purezza:98%Colore e forma:SolidPeso molecolare:1060.221Tyroserleutide TFA (138168-48-6 free base)
Tyroserleutide TFA: a tripeptide from porcine spleen; inhibits tumor growth in vitro/in vivo.Formula:C20H28F3N3O8Purezza:98%Colore e forma:SolidPeso molecolare:495.45WT-1 A1
CAS:WT-1 A1 is an attractive target for immunotherapy in patients with pancreatic adenocarcinoma.Formula:C55H74N10O13SPurezza:98%Colore e forma:SolidPeso molecolare:1115.3Tos-Gly-Pro-Arg-ANBA-IPA acetate
CAS:Tos-Gly-Pro-Arg-ANBA-IPA (acetate) is a peptide substrate for luminescence measurement.Formula:C32H45N9O10SPurezza:98%Colore e forma:SolidPeso molecolare:747.82Pressinoic Acid
CAS:Pressinoic Acid is a peptide with potent corticotrophin-releasing activity. It is also an oxytocin inhibitor; it induces maternal behavior.Formula:C33H42N8O10S2Purezza:98%Colore e forma:SolidPeso molecolare:774.86Tetanus toxin (830-843)
CAS:Tetanus toxin (830-843) activates T cells; used as an adjuvant in vaccines.Formula:C74H118N18O22Purezza:98%Colore e forma:SolidPeso molecolare:1611.84Acetyl decapeptide-3
CAS:Acetyl decapeptide-3 is a peptide that can stimulate collagen and elastin to increase skin elasticity and increase cell growth and improve healing and repair.Formula:C68H95N19O17Purezza:98%Colore e forma:SolidPeso molecolare:1450.6TAT TFA (191936-91-1 free base)
TAT TFA (YGRKKRRQRRR) is derived from human immunodeficiency virus (hiv-1) transcription reverse activator TAT, is a cell penetrating peptide.
Formula:C66H119N32F3O16Purezza:98%Colore e forma:SolidPeso molecolare:1673.85Trempamotide
CAS:Trempamotide is a bioactive chemical.Formula:C58H80N10O18Purezza:98%Colore e forma:SolidPeso molecolare:1205.31PYX 1
CAS:PYX 1 is an effective orexigenic peptide.Formula:C70H105Cl2N19O16Purezza:98%Colore e forma:SolidPeso molecolare:1539.61C-Peptide, dog
CAS:Dog C-Peptide, part of proinsulin, is secreted by pancreatic beta cells with insulin; vital for insulin biosynthesis, once deemed inert.Formula:C137H225N37O49Purezza:98%Colore e forma:SolidPeso molecolare:3174.47Conotoxin GII
CAS:Conotoxin GII is a highly toxic peptide.Formula:C57H81N19O16S4Purezza:98%Colore e forma:SolidPeso molecolare:1416.63[Pro3]-GIP (Rat)
Rat GIP receptor partial agonist with Kd of 13 nM, boosts cAMP in COS-7 cells, competitively antagonizes GIP.Formula:C226H343N61O64SPurezza:98%Colore e forma:SolidPeso molecolare:4970.63Cenupatide
CAS:Cenupatide: uPAR inhibitor; improves kidney in diabetic rats; inhibits FPR2. No effect on podocyte uPAR levels/activity.Formula:C28H47N11O5Purezza:98%Colore e forma:SolidPeso molecolare:617.756Somatostatin 1-28
CAS:Somatostatin receptor agonist, derived from the post-translational cleavage of prosomatostatin.Formula:C137H207N41O39S3Purezza:98%Colore e forma:SolidPeso molecolare:3149Peptide C105Y
CAS:C105Y, a synthetic peptide mimicking alpha1-antitrypsin residues 359-374, boosts DNA nanoparticle gene expression.Formula:C97H148N20O23SPurezza:98%Colore e forma:SolidPeso molecolare:1994.4N-Oleoyl Glutamine
CAS:N-Oleoyl Glutamine (Oleoyl-L-glutamine) antagonizes TRPV1 of the transient receptor potential (TRP) calcium channel.
Formula:C23H42N2O4Purezza:99.61%Colore e forma:SolidPeso molecolare:410.59Fmoc N-hydroxysuccinimide ester
CAS:Formula:C19H15NO5Purezza:≥ 98.0%Colore e forma:White to off-white crystalline powderPeso molecolare:337.34Bis(tetramethylene)fluoroformamidinium hexafluorophosphate
CAS:Formula:C9H16F7N2PPeso molecolare:316.20α-Gliadin (43-49)
CAS:alpha-Gliadin (43-49) is a Gliadian sequence peptide. It could induce leukocyte migration inhibition but be blocked by naloxone.Formula:C43H57N9O11Purezza:98%Colore e forma:SolidPeso molecolare:875.97ACTH (1-13)
CAS:ACTH (1-13), a 13-amino acid peptide, protects rats' stomachs from ethanol damage; it’s a stress-response hormone from the pituitary.Formula:C75H106N20O19SPurezza:98%Colore e forma:SolidPeso molecolare:1623.836-CR110 Single isomer
CAS:6-CR110 Single isomer is a rhodamine-class green fluorescent dye with ex/em=499/525 nm for DNA or protein labelling and cell staining.Formula:C21H15N2O5ClPurezza:98%Colore e forma:SolidPeso molecolare:410.81D-Lys(Z)-Pro-Arg-pNA
CAS:D-Lys(Z)-Pro-Arg-pNA is a luminescent substrate of activated protein C (APC).Formula:C31H43N9O7Purezza:98%Colore e forma:SolidPeso molecolare:653.73PUMA BH3 (TFA)
PUMA BH3 (TFA) is a p53 upregulated modulator of apoptosis (PUMA) BH3 domain peptide, acts as a direct activator of Bak, with a Kd of 26 nM.Formula:C130H203F3N42O45SPurezza:98%Colore e forma:SolidPeso molecolare:3163.32O-(1H-6-Chlorobenzotriazol-1-yl)-1,1,3,3-tetramethyluronium hexafluorophosphate
CAS:Formula:C11H15ClF6N5OPPurezza:≥ 99.0%Colore e forma:White to off-white crystalline powderPeso molecolare:413.69Gly-Arg-Gly-Asp-Ser (TFA)(96426-21-0,free)
Gly-Arg-Gly-Asp-Ser (GRGDS) is a cell binding protein domain derived from the cell-binding region of fibronectin. Osteopontin uses this motif for cell adhesion.Formula:C19H31F3N8O11Purezza:98%Colore e forma:SolidPeso molecolare:604.49Foxy-5 TFA(881188-51-8 free base)
Foxy-5, a WNT5A-mimicking peptide, curbs cancer cell movement by altering calcium signaling, not β-catenin.
Formula:C28H43F3N6O14S2Purezza:98%Colore e forma:SolidPeso molecolare:808.8Rhodopsin Epitope Tag
Rhodopsin Epitope Tag: 9-amino acid peptide from bovine rhodopsin C terminus, recognized by anti-rhodopsin antibodies.Formula:C37H62N10O16Purezza:98%Colore e forma:SolidPeso molecolare:902.95Adrenomedullin (AM) (13-52), human
CAS:Adrenomedullin (13-52) is a 40-residue peptide, with a disulfide bridge, binding to its receptor with high affinity.Formula:C200H308N58O59S2Purezza:98%Colore e forma:SolidPeso molecolare:4533.1Tiplimotide
CAS:Tiplimotide is an altered peptide ligand (APL).Formula:C87H142N24O21Purezza:98%Colore e forma:SolidPeso molecolare:1860.21Kv3, Channel Containing Protein 567-585
Kv3.1b channel protein, in PV+ pallidal neurons, spans amino acids 567-585.Formula:C93H156N24O28S2Purezza:98%Colore e forma:SolidPeso molecolare:2122.5Ige decapeptide
CAS:Ige decapeptide is a peptide.Formula:C55H80N12O13Purezza:98%Colore e forma:SolidPeso molecolare:1117.3Gastrin hexapeptide
CAS:Gastrin hexapeptide is a hexapeptide from porcine antral mucosa.Formula:C40H48N8O9SPurezza:98%Colore e forma:SolidPeso molecolare:816.92BDC2.5 mimotope 1040-31
CAS:Mimotope 1040-31 agonizes diabetogenic BDC2.5 T-cells, specifically targets BDC2.5 TCR Tg+ cells, known as p31.Formula:C63H97N17O14SPurezza:98%Colore e forma:SolidPeso molecolare:1348.61S961 TFA (1083433-49-1 free base)
S961 TFA: Insulin receptor antagonist; IC50: hir-a 0.048 nM, hir-b 0.027 nM, higf-ir 630 nM.Formula:C211H297N55O71S2·xC2HF3O2Purezza:98%Colore e forma:SolidPeso molecolare:N/ATAT-amide TFA (697226-52-1 free base)
TAT-amide TFA is a cell penetrating peptide. The cell - penetrating peptides (CPPs) is a kind of access to the short amino acid sequence of different cells.Formula:C66H120F3N33O15Purezza:98%Colore e forma:SolidPeso molecolare:1672.87NH2-KLGADTDGEQDQHMTYGGQ-COOH
NH2-QGGYTMHQDQEGDTDAGLK-COOH is a synthetic peptide chain consisting of a primary amine group attached to lysine and a carboxyl group attached to glutamine.Formula:C83H127N25O34SPurezza:98%Colore e forma:SolidPeso molecolare:2051.11IGF-I (24-41) TFA (135861-49-3 free base)
IGF-I (24-41) (TFA) is a fragment of IGF-I with anabolic, antioxidant, anti-inflammatory, and cytoprotective properties.Formula:C88H133N27O28·C2HF3O2Purezza:98%Colore e forma:SolidPeso molecolare:2131.18Peptide pva
CAS:Peptide pva, encoded by an RNA, is complementary to arginine vasopressin mRNA.Formula:C44H68N10O14Purezza:98%Colore e forma:SolidPeso molecolare:961.07Thelenotoside B
CAS:Thelenotoside B is a triterpene tetraglycoside.Formula:C55H88O23Purezza:98%Colore e forma:SolidPeso molecolare:1117.286BAD (103-127) (human) acetate
BAD (103-127) (human) acetate is a 25-mer Bad polypeptide from the BAD BH3 domain that antagonizes the effects of Bcl-xl.Formula:C139H216N42O41SPurezza:96.97%Colore e forma:SolidPeso molecolare:3163.52Sarasinoside A1
CAS:Sarasinoside A1 is a triterpenoid saponin that reverses mesenchymal tumor transformation.Formula:C62H100N2O26Purezza:98%Colore e forma:SolidPeso molecolare:1289.47Arg-Gly-Asp-Cys
CAS:Arg-Gly-Asp-Cys is the binding motif of fibronectin and cell adhesion molecules, which can inhibit platelet aggregation and fibrinogen binding.Formula:C15H27N7O7SPurezza:98%Colore e forma:SolidPeso molecolare:449.48[pThr3]-CDK5 Substrate (TFA)
[pThr3]-CDK5 Substrate TFA is an effective Phospho-Thr3CDK5 Substrate. [pThr3]-CDK5 Substrate is phosphorylated by CDK5 with a Km value of 6 µM.Formula:C55H101F3N15O17PPurezza:98%Colore e forma:SolidPeso molecolare:1332.45G3-C12 TFA (848301-94-0 free base)
G3-C12 TFA Salt is a specific galectin-3 binding peptide with Ksubdsub of 88 nM and shows anticancer activity.Formula:C74H115N23O23S2·C2HF3O2Purezza:98%Colore e forma:SolidPeso molecolare:1873Acetyl-Calpastatin (184-210)(human) acetate
Acetyl-Calpastatin acetate inhibits µ-calpain (Ki=0.2nM) and cathepsin L (Ki=6μM) selectively and reversibly.
Formula:C144H234N36O46SPurezza:97.84% - 98.16%Colore e forma:SolidPeso molecolare:3237.68N,N''-Carbonyldiimidazole
CAS:Formula:C7H6N4OPurezza:(Titration) ≥ 97.0%Colore e forma:White, off-white or pale yellow powder or crystalsPeso molecolare:162.15Ziconotide TFA (107452-89-1 free base)
Ziconotide TEA blocks N-type calcium channels on pain pathway neurons, dampening synapse activity and providing strong pain relief.Formula:C116H179F21N36O46S7Purezza:98%Colore e forma:SolidPeso molecolare:3437.3GroES mobile loop
GroES mobile loop is a flexible region of unbound GroES that interacts with GroEL via the residues located at the tip of the loop.Formula:C51H90N14O20Purezza:98%Colore e forma:SolidPeso molecolare:1219.4eukaryotic translation initiation factor 3
Eukaryotic initiation factors (eIF) are proteins involved in the initiation phase of eukaryotic translation.
Formula:C47H84N14O14SPurezza:98%Colore e forma:SolidPeso molecolare:1101.32Caerulein, desulfated TFA (20994-83-6 free base)
Caerulein, desulfated TFA, is a desulfurized decapeptide similar to gastrin/CCK's five C-terminal amino acids.Formula:C60H74F3N13O20SPurezza:98%Colore e forma:SolidPeso molecolare:1386.36SIYRY
CAS:SIYRY is a Kb-restricted epitope peptide.Formula:C50H71N11O13Purezza:98%Colore e forma:SolidPeso molecolare:1034.16Ac-IEVDIDV (TFA)
Ac-IEVDIDV TFA is a short peptide sequence.Formula:C39H62F3N7O17Purezza:98%Colore e forma:SolidPeso molecolare:957.94PKC ζ pseudosubstrate
Inhibitor of protein kinase C (PKC) ζ; attached to cell permeabilisation Antennapedia domain vector peptide.Formula:C208H336N74O44S3Purezza:98%Colore e forma:SolidPeso molecolare:4673.59C-Reactive Protein (CRP) (77-82)
CAS:CRP 77-82 is a fragment of CRP, a pentameric, plasma protein that marks inflammation and cardiovascular risk, rising with IL-6 from macrophages/T cells.
Formula:C23H40N6O10Purezza:98%Colore e forma:SolidPeso molecolare:560.61Z-Asp(OBzl)-OH
CAS:Z-Asp(OBzl)-OH (N-Cbz-L-Aspartic acid 4-benzyl ester) is an aspartic acid derivative.Formula:C19H19NO6Purezza:98.71%Colore e forma:SolidPeso molecolare:357.36A2-Binding peptide
CAS:A2-Binding peptide has involved in the assembly of MHC Class I molecules.Formula:C61H106N14O15Purezza:98%Colore e forma:SolidPeso molecolare:1275.602Acv tripeptide
CAS:Acv tripeptide is a crucial precursor in penicillin and cephalosporin biosyntheses.Formula:C14H25N3O6SPurezza:98%Colore e forma:SolidPeso molecolare:363.43RI-STAD 2
AKAP disruptor binds PKA-RIα/β (KD 6.2/12.1nM), blocks AKAP interaction, inhibits type I PKA phosphorylation, cell-permeable.Formula:C109H181N25O35Purezza:98%Colore e forma:SolidPeso molecolare:2401.75CGGRGD TFA (1260223-44-6 free base)
CGGRGD TFA synthesized via solid-phase synthesis; PCL fibers aminolysed with amino 2-cyanobenzothiazole, then CBT added.Formula:C21H34F3N9O11SPurezza:98%Colore e forma:SolidPeso molecolare:677.61[Sar9,Met(O2)11]-Substance P TFA(110880-55-2,free)
Selective NK1 receptor agonist; increases MAP, HR, face washing, sniffing; unique in causing grooming.Formula:C66H101N18F3O17SPurezza:98%Colore e forma:SolidPeso molecolare:1507.68α1BAla
CAS:alpha1BAla is a partially alpha-helical peptide.Formula:C70H121N21O25SPurezza:98%Colore e forma:SolidPeso molecolare:1688.9β-Endorphin, equine (TFA)
β-Endorphin, equine (TFA) is an endogenous opioid peptide, which binds at high affinity to both μ/δ opioid receptors.Formula:C156H249F3N42O46SPurezza:98%Colore e forma:SolidPeso molecolare:3537.96Benzotriazole-1-yl-oxy-tris-pyrrolidino-phosphonium hexafluorophosphate
CAS:Formula:C18H28N6OP·PF6Purezza:≥ 97.5%Colore e forma:White to off-white or slightly yellow crystalline powderPeso molecolare:520.40Fibronectin Adhesion-promoting Peptide
CAS:Heparin-binding peptide aids adhesion, part of fibronectin's carboxy-terminal domain.Formula:C47H74N16O10Purezza:98%Colore e forma:SolidPeso molecolare:1023.19EGF Receptor Substrate 2 Phospho-Tyr5
EGF Receptor Substrate 2 (Phospho-Tyr5) is a biologically active peptide derived from an autophosphorylation site (Tyr992) of EGFR.Formula:C54H82N13O24Purezza:98%Colore e forma:SolidPeso molecolare:1328.28Ornithine glutamate dipeptide
CAS:Ornithine glutamate dipeptide is a amino acid.Formula:C10H19N3O5Purezza:98%Colore e forma:SolidPeso molecolare:261.27Myristoyl tripeptide-1
CAS:Myristoyl tripeptide-1 is a peptide.Formula:C28H50N6O5Purezza:98%Colore e forma:SolidPeso molecolare:550.73HBTU
CAS:Formula:C11H16F6N5OPPurezza:≥ 99.0%Colore e forma:White to almost white powder or crystalsPeso molecolare:379.25Protein Kinase C (19-31) (TFA)(121545-65-1,free)
Protein Kinase C (19-31) TFA is a serine-modified PKCa-derived inhibitor for testing PKC activity.Formula:C69H119F3N26O18Purezza:98%Colore e forma:SolidPeso molecolare:1657.84MARK Substrate
CAS:MARK Substrate is a MARK substrate peptide.Formula:C60H108N18O21Purezza:98%Colore e forma:SolidPeso molecolare:1417.61Adrenomedullin (AM) (1-52), human TFA
Adrenomedullin (AM) (1-52), human (TFA) is an NH2 terminal truncated adrenomedullin analogue,affects cell proliferation and angiogenesis in cancer.Formula:C266H407F3N80O79S3Purezza:98%Colore e forma:SolidPeso molecolare:6142.76CCP peptide
CAS:CCP peptide is a synthetic cyclic peptide incorporating the amino acid citrulline.Formula:C87H145N41O32S2Purezza:98%Colore e forma:SolidPeso molecolare:2341.47ω-Conotoxin MVIID
ω-Conotoxin MVIID (SNX-238) is a peptide from the Conus genus that inhibits the ω-Conotoxin-GVIA-sensitive, high-threshold calcium (Ca 2+) current in fishFormula:C99H164N42O33S7Purezza:98%Colore e forma:SolidPeso molecolare:2695.08Imperatoxin A
CAS:Imperatoxin A, a peptide toxin sourced from the African scorpion Pandinus imperator, functions as an activator of Ca2+-release channels/ryanodine receptors (Formula:C148H254N58O45S6Purezza:98%Colore e forma:SolidPeso molecolare:3758.35PTPσ Inhibitor, ISP
PTPσ Inhibitor ISP is a compound that binds to recombinant human PTPs, thereby inhibiting PTPσ signaling.Formula:C177H306N66O54S3Purezza:98%Colore e forma:SolidPeso molecolare:4318.93X-press Tag Peptide
X-press Tag: an N-terminal peptide with polyhistidine, T7 gene 10 Xpress epitope, and enterokinase site, detected by anti-Xpress antibodies.Formula:C41H59N9O20Purezza:98%Colore e forma:SolidPeso molecolare:997.96Ceratotoxin-1
Ceratotoxin-1 (CcoTx1) is a peptide toxin that functions as an inhibitor of various voltage-gated sodium channel subtypes.Formula:C172H256N52O50S6Purezza:98%Colore e forma:SolidPeso molecolare:4044.58Phrixotoxin-1
CAS:Phrixotoxin 1, a specific peptide inhibitor of Kv4 potassium channels, originates from the venom of the theraphosid spider Phrixotrichus auratus [1] [2].Formula:C156H246N44O37S7Purezza:98%Colore e forma:SolidPeso molecolare:3554.35Fluorescein-6-carbonyl-Asp(OMe)-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone
CAS:Fluorescein-6-carbonyl-Asp(OMe)-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone is a cell-permeable, non-toxic inhibitor that irreversibly binds to activatedFormula:C43H45FN4O16Purezza:98%Colore e forma:SolidPeso molecolare:892.83CTP-NBD
CAS:CTP-NBD is a cell-permeable, specific inhibitor of the NFκB peptide, which has been utilized in studies of colitis [1] [2].Formula:C121H194N46O32Purezza:98%Colore e forma:SolidPeso molecolare:2805.12Allatostatin IV
CAS:Allatostatin IV, an insect octapeptide, regulates juvenile hormone synthesis.Formula:C45H68N12O12Purezza:98%Colore e forma:SolidPeso molecolare:969.09Phe-Met-Arg-Phe Like Peptide, Snail Helix aspersa
CAS:FMRF is a 4-residue neuropeptide from Helix aspersa snail muscles.Formula:C44H61N11O10Purezza:98%Colore e forma:SolidPeso molecolare:904.02Biotin-myelin basic protein (94-102)
CAS:Biotin-myelin basic protein (94-102) is a peptide fragment crucial for myelin adhesion within the nervous system, facilitating myelination.Formula:C49H84N20O13SColore e forma:SolidPeso molecolare:1193.38TLQP-30
CAS:TLQP-21 peptide boosts metabolism, regulates temperature, and counters high-fat diet weight/hormonal effects in mice.Formula:C150H232N54O40Purezza:98%Colore e forma:SolidPeso molecolare:3431.78Type A Allatostatin I
CAS:Type A Allatostatin I: tridecapeptide, inhibits juvenile hormone synthesis in insects, pleiotropic neuropeptide.Formula:C61H94N18O16Purezza:98%Colore e forma:SolidPeso molecolare:1335.51EDC hydrochloride
CAS:Formula:C8H17N3·HClPurezza:(HPLC) ≥ 98.0%Colore e forma:White to off-white crystalline powderPeso molecolare:191.70Prolactin Releasing Peptide (12-31), human
CAS:Prolactin Releasing Peptide (1-31), human is a high affinity GPR10 ligand that cause the release of the prolactinFormula:C104H158N32O26Purezza:98%Colore e forma:SolidPeso molecolare:2272.57mP6
CAS:mP6 (Myr-FEEERA-OH), a myristoylated peptide, selectively inhibits Gα 13's interaction with integrin β 3 while preserving talin-dependent integrin function.Formula:C47H75N9O14Purezza:98%Colore e forma:SolidPeso molecolare:990.15Thioredoxin reductase peptide
CAS:TrxR peptide (53-67) aids TrxR research, has C-terminal selenylsulfide, similar to glutathione reductase.Formula:C66H106N18O18S2Purezza:98%Colore e forma:SolidPeso molecolare:1503.79β-MSH (1-22) human TFA (17908-57-5 free base)
β-Melanocyte Stimulating Hormone (MSH) is a 22-residue human peptide acting as a melanocortin-4 receptor agonist.Formula:C120H175F3N34O37SPurezza:98%Colore e forma:SolidPeso molecolare:2774.94PKItide
CAS:PKItide demonstrates an inhibitory concentration 50 (IC50) of 0.2 μM against cAMP-dependent protein kinase (cAMP-PK) [1].Formula:C85H149N31O24Purezza:98%Colore e forma:SolidPeso molecolare:1989.29Pezadeftide
CAS:Pezadeftide, a potent antifungal peptide, readily penetrates fungal cells, eliciting an immediate mitochondrial response that leads to hyperpolarization of thePurezza:98%Colore e forma:SolidAD 01
CAS:FKBPL-based peptide increases CD44, hinders BCSC growth, impacts pluripotency, inhibits angiogenesis, and blocks tumor growth in models.Formula:C115H187N33O42Purezza:98%Colore e forma:SolidPeso molecolare:2703.94H-Ala-Ala-Tyr-OH (TFA) (67131-52-6 free base)
H-Ala-Ala-Tyr-OH TFA can be synthesized mutant peptides.Formula:C17H22F3N3O7Purezza:98%Colore e forma:SolidPeso molecolare:437.37Colistin A
CAS:Colistin A, from Paenibacillus polymyxa, is an antibiotic effective against Gram-negative bacilli, part of the polymyxin class.
Formula:C53H100N16O13Purezza:98%Colore e forma:SolidPeso molecolare:1169.46PKCη pseudosubstrate inhibitor,myristoylated
CAS:Myristoylated PKCη pseudosubstrate inhibitor is a cell-permeable compound utilized to investigate the mechanism of action of PKCη [1].Formula:C101H185N41O23SPurezza:98%Colore e forma:SolidPeso molecolare:2373.88A-71915 TFA (132956-87-7 free base)
A-71915 (TFA) selectively blocks ANP receptor, causing cell death and reduced insulin in RINm5F β-cells.Formula:C71H117F3N26O17S2Purezza:98%Colore e forma:SolidPeso molecolare:1727.98Laminin (925-933)
CAS:Laminin 925-933 is a peptide originating from residues 925-933 of the laminin B1 chain, known for its binding affinity to the laminin receptor.Formula:C40H62N12O14SPurezza:98%Colore e forma:SolidPeso molecolare:967.06LSD
CAS:LSD-phthalocyanine is a conjugated compound utilized in photoimmunology research [1].Formula:C39H72N14O13S2Colore e forma:SolidPeso molecolare:1009.21RAD17-derived Peptide TFA
RAD17-derived peptide, a substrate for the ataxia-telangiectasia and RAD3-related protein/kinase (ATR), facilitates the identification of ATR inhibitors.Formula:C81H132N22O25·XCF3COOHColore e forma:SolidPeso molecolare:1814.10Ac-IEVDIDVEH (TFA)
Ac-IEVDIDVEH TFA is a short peptide sequence with Ac at the end.Formula:C50H76F3N11O21Purezza:98%Colore e forma:SolidPeso molecolare:1224.19Fz7-21 TFA (2247635-23-8 free base)
Fz7-21 TFA is a peptide that blocks FZD7 receptors, with EC50 of 58 nM (human) and 34 nM (mouse).Formula:C85H115N18F3O25S2Purezza:98%Colore e forma:SolidPeso molecolare:1910.07
![[SER140]-PLP(139-151)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1312.webp&w=3840&q=75)
![coagulation factor II (thrombin) B chain fragment [Homo sapiens]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2234.webp&w=3840&q=75)
