Peptidi
Sottocategorie di "Peptidi"
Trovati 29635 prodotti di "Peptidi"
Ref: 3D-VAC-00171
Prodotto fuori produzioneDynorphin A (2-12), porcine
Catalogue peptide; min. 95% purity
Formula:C60H105N21O12Peso molecolare:1,312.64 g/molRef: 3D-VAC-00419
Prodotto fuori produzioneDynorphin A (3-8), porcine
Catalogue peptide; min. 95% purity
Formula:C35H60N12O7Peso molecolare:760.94 g/molRef: 3D-VAC-00411
Prodotto fuori produzioneCalcineurin Autoinhibitory Fragment
Catalogue peptide; min. 95% purity
Formula:C124H205N39O39S2Peso molecolare:2,930.38 g/molRef: 3D-VAC-00514
Prodotto fuori produzioneBTK derived peptide
Catalogue peptide; min. 95% purity
Formula:C72H115N17O18S2Peso molecolare:1,570.95 g/molRef: 3D-VAC-00536
Prodotto fuori produzioneSarafotoxin S6d
Catalogue peptide; min. 95% purity
Formula:C112H167N27O34S5Peso molecolare:2,596 g/molRef: 3D-VAC-00294
Prodotto fuori produzioneRef: 3D-VAC-00718
Prodotto fuori produzioneRef: 3D-VAC-00213
Prodotto fuori produzioneAngiotensin II Receptor, AT2, Amino Terminal Fragment
Catalogue peptide; min. 95% purity
Formula:C79H125N23O28SPeso molecolare:1,877.08 g/molRef: 3D-VAC-00602
Prodotto fuori produzioneBiotin-Kinase Domain of Insulin Receptor (2)
Catalogue peptide; min. 95% purity
Formula:C72H122N21O29SPeso molecolare:1,777.92 g/molRef: 3D-VAC-00122
Prodotto fuori produzioneAngiotensinogen (1-13)
Catalogue peptide; min. 95% purity
Formula:C79H116N22O17Peso molecolare:1,645.9 g/molRef: 3D-VAC-00344
Prodotto fuori produzione[Phe22] Big Endothelin-1 (19-37), human
Catalogue peptide; min. 95% purity
Formula:C104H152N26O26Peso molecolare:2,182.53 g/molRef: 3D-VAC-00505
Prodotto fuori produzione[Tyr0]-Hypercalcemia Malignancy Factor (1-40)
Catalogue peptide; min. 95% purity
Formula:C216H343N67O60Peso molecolare:4,838.43 g/molRef: 3D-VAC-00857
Prodotto fuori produzioneCJC-1295
CAS:CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.
Purezza:Min. 95%beta-Endorphin (27-31) (human)
Catalogue peptide; min. 95% purity
Formula:C28H45N7O9Peso molecolare:623.71 g/molRef: 3D-VAC-00890
Prodotto fuori produzioneBiotinyl-MCH (salmon)
Catalogue peptide; min. 95% purity
Formula:C99H153N29O26S5Peso molecolare:2,325.82 g/molRef: 3D-VAC-00086
Prodotto fuori produzioneRef: 3D-VAC-00224
Prodotto fuori produzioneBiotin-Glucagon (1-29), bovine, human, porcine
Catalogue peptide; min. 95% purity
Formula:C163H239N45O51S2Peso molecolare:3,709.03 g/molRef: 3D-VAC-00100
Prodotto fuori produzioneSomatostatin-28 (1-14)
Catalogue peptide; min. 95% purity
Formula:C61H105N23O21SPeso molecolare:1,528.72 g/molRef: 3D-VAC-00704
Prodotto fuori produzioneAmylin (human) trifluoroacetate salt
CAS:Amylin is a hormone that regulates the release of insulin from the pancreas. Amylin is a protein that consists of 39 amino acids, and in its natural form it is not soluble in water. The amyloid fibrils are insoluble aggregates of proteins that can be found in the brain tissue of patients with Alzheimer's disease. Amylin has been shown to have an entrapment efficiency greater than 96% by using polymeric particles with a diameter less than 50 microns. These particles are able to increase water solubility and nutrient metabolism, as well as improve evaporation rates. They also provide an increased surface area for absorption and pharmacological properties. Amylin has been shown to lower postprandial glycemia when used with insulin in type II diabetes mellitus patients, and may also be an anorectic agent.
Formula:C165H261N51O55S2Purezza:Min. 95%Peso molecolare:3,903.28 g/molBiotin-Neuromedin S (rat)
Catalogue peptide; min. 95% purity
Formula:C67H87N15O14Peso molecolare:1,326.53 g/molRef: 3D-VAC-00102
Prodotto fuori produzioneTryptophan Motif Peptide
Catalogue peptide; min. 95% purity
Formula:C35H41N11O7Peso molecolare:727.79 g/molRef: 3D-VAC-00424
Prodotto fuori produzioneNTB (Naltriben)
Catalogue peptide; min. 95% purity
Formula:C50H65N11O11S2Peso molecolare:1,060.29 g/molRef: 3D-VAC-00140
Prodotto fuori produzioneAdrenomedullin (1-52), porcine
Catalogue peptide; min. 95% purity
Formula:C262H403N79O76S3Peso molecolare:5,971.67 g/molRef: 3D-VAC-00918
Prodotto fuori produzioneTGF α(34-43) (rat)
Catalogue peptide; min. 95% purity
Formula:C44H67N15O13S2Peso molecolare:1,078.25 g/molRef: 3D-VAC-00277
Prodotto fuori produzioneP62 (417-429), M. leprae
Catalogue peptide; min. 95% purity
Formula:C65H116N16O17Peso molecolare:1,393.75 g/molRef: 3D-VAC-00573
Prodotto fuori produzionegp120, HIV-1 MN
Catalogue peptide; min. 95% purity
Formula:C135H221N45O33Peso molecolare:3,002.55 g/molRef: 3D-VAC-00900
Prodotto fuori produzioneInsulin Receptor (1142-1153)
Catalogue peptide; min. 95% purity
Formula:C72H107N19O24Peso molecolare:1,622.77 g/molRef: 3D-VAC-00774
Prodotto fuori produzioneSynaptobrevin-2 (75-78) (human, bovine, mouse, rat)
Catalogue peptide; min. 95% purity
Formula:C23H33N5O9Peso molecolare:523.55 g/molRef: 3D-VAC-00640
Prodotto fuori produzioneC-Reactive Protein (CRP) (77-82)
Catalogue peptide; min. 95% purity
Formula:C23H40N6O10Peso molecolare:560.61 g/molRef: 3D-VAC-00793
Prodotto fuori produzioneBiotin-[Glu1]-Gastrin I (human) (phosphorylated)
Catalogue peptide; min. 95% purity
Formula:C107H141N22O37PS2Peso molecolare:2,422.53 g/molRef: 3D-VAC-00087
Prodotto fuori produzionePKA Inhibitor Substrate
Catalogue peptide; min. 95% purity
Formula:C61H108N25O22PPeso molecolare:1,574.69 g/molRef: 3D-VAC-00448
Prodotto fuori produzioneRef: 3D-VAC-00358
Prodotto fuori produzioneAloc-DL-Orn (Boc)-OH·DCHA
CAS:Prodotto controllatoPlease enquire for more information about Aloc-DL-Orn (Boc)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C14H24N2O6·C12H23NPurezza:Min. 95%Peso molecolare:497.67 g/molRef: 3D-FA107927
Prodotto fuori produzioneRef: 3D-VAC-00339
Prodotto fuori produzioneHuman CMV Assemblin Protease Substrate (M-site)
Catalogue peptide; min. 95% purity
Formula:C52H96N20O16Peso molecolare:1,257.47 g/molRef: 3D-VAC-00665
Prodotto fuori produzioneα-Bag Cell Peptide (1-8)
Catalogue peptide; min. 95% purity
Formula:C47H72N14O11Peso molecolare:1,009.19 g/molRef: 3D-VAC-00246
Prodotto fuori produzione[Trp11] Neurotensin (8-13)
Catalogue peptide; min. 95% purity
Formula:C40H65N13O7Peso molecolare:840.05 g/molRef: 3D-VAC-00688
Prodotto fuori produzioneAlpha-Dendrotoxin
CAS:Alpha-dendrotoxin is a type of neurotoxin that blocks the voltage-gated sodium channel, which provides the neuron with a steady supply of energy. This toxin is found in the venom of certain snakes and can cause paralysis and death. Alpha-dendrotoxin binds to site 1 on the voltage-gated sodium channel and prevents it from opening. It does this by binding to its receptor, which is located on the inside surface of the cell membrane, thus blocking other ions from entering or leaving the cell. The blockage of ions leads to neuronal function impairment, such as memory loss or muscle paralysis.
Formula:C305H472N98O84S6Purezza:Min. 95 Area-%Colore e forma:PowderPeso molecolare:7,048.02 g/molRef: 3D-VAC-00673
Prodotto fuori produzioneVasoactive Intestinal Contractor [VIC]
Catalogue peptide; min. 95% purity
Formula:C116H161N27O32S4Peso molecolare:2,573.99 g/molRef: 3D-VAC-00288
Prodotto fuori produzioneα-Conotoxin IMI
Catalogue peptide; min. 95% purity
Formula:C52H74N20O15S4Peso molecolare:1,347.58 g/molRef: 3D-VAC-00405
Prodotto fuori produzioneAc-Adhesin (1025-1044) amide
Catalogue peptide; min. 95% purity
Formula:C97H160N26O32Peso molecolare:2,202.51 g/molRef: 3D-VAC-00042
Prodotto fuori produzione[Pyr11]-Amyloid beta-Protein (11-40)
Catalogue peptide; min. 95% purity
Formula:C143H226N38O39SPeso molecolare:3,133.71 g/molRef: 3D-VAC-00202
Prodotto fuori produzioneRef: 3D-VAC-00183
Prodotto fuori produzioneCrustacean Erythrophore Concentrating Hormone
Catalogue peptide; min. 95% purity
Formula:C45H59N11O11Peso molecolare:930.04 g/molRef: 3D-VAC-00190
Prodotto fuori produzioneBiotin-LC-Neurogranin (28-43)
Catalogue peptide; min. 95% purity
Formula:C94H159N31O20S2Peso molecolare:2,139.48 g/molRef: 3D-VAC-00065
Prodotto fuori produzioneProlactin Releasing Peptide (12-31), bovine
Catalogue peptide; min. 95% purity
Formula:C103H156N32O25Peso molecolare:2,242.59 g/molRef: 3D-VAC-00767
Prodotto fuori produzione[Ile-Ser]-Bradykinin (T-Kinin)
Catalogue peptide; min. 95% purity
Formula:C59H89N17O14Peso molecolare:1,260.47 g/molRef: 3D-VAC-00511
Prodotto fuori produzioneH-SIYRYYGL-OH
Peptide H-SIYRYYGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ref: 3D-PP46914
Prodotto fuori produzioneRef: 3D-VAC-00717
Prodotto fuori produzione[Thr46]-Osteocalcin (45-49) (human)
Catalogue peptide; min. 95% purity
Formula:C25H37N5O7Peso molecolare:519.6 g/molRef: 3D-VAC-00401
Prodotto fuori produzionePrésure. 10. 145-148
Catalogue peptide; min. 95% purity
Formula:C46H59N7O12Peso molecolare:902.02 g/molRef: 3D-VAC-00263
Prodotto fuori produzioneRef: 3D-VAC-00856
Prodotto fuori produzione[Gln11]-beta-Amyloid (1-28)
Catalogue peptide; min. 95% purity
Formula:C145H210N42O45Peso molecolare:3,261.54 g/molRef: 3D-VAC-00315
Prodotto fuori produzioneProinsulin C-peptide (55-89), human
Catalogue peptide; min. 95% purity
Formula:C153H259N49O52Peso molecolare:3,616.98 g/molRef: 3D-VAC-00682
Prodotto fuori produzioneAc-Endothelin-1 (16-21), human
Catalogue peptide; min. 95% purity
Formula:C41H59N9O10Peso molecolare:837.98 g/molRef: 3D-VAC-00033
Prodotto fuori produzione[Ala4]-MBP (1-11)
Catalogue peptide; min. 95% purity
Formula:C49H81N21O17Peso molecolare:1,236.32 g/molRef: 3D-VAC-00021
Prodotto fuori produzioneRef: 3D-VAC-00820
Prodotto fuori produzioneRef: 3D-VAC-00574
Prodotto fuori produzione(D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH
CAS:Please enquire for more information about (D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C59H84N18O14Purezza:Min. 95%Peso molecolare:1,269.41 g/molRef: 3D-FS109491
Prodotto fuori produzioneH-Ser-Ile-Lys-Val-Ala-Val-OH
CAS:H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when
Formula:C28H53N7O8Purezza:Min. 95%Peso molecolare:615.76 g/molRef: 3D-FS108741
Prodotto fuori produzioneBiotin-a-CGRP (canine, mouse, rat)
Catalogue peptide; min. 95% purity
Formula:C172H276N52O54S3Peso molecolare:4,032.63 g/molRef: 3D-VAC-00115
Prodotto fuori produzioneGAD65 (78-97)
Catalogue peptide; min. 95% purity
Formula:C97H148N26O29S2Peso molecolare:2,206.53 g/molRef: 3D-VAC-00543
Prodotto fuori produzioneTNF-α(71-82), human
Catalogue peptide; min. 95% purity
Formula:C51H91N19O18Peso molecolare:1,258.41 g/molRef: 3D-VAC-00735
Prodotto fuori produzioneMARCKS Substrate (151-175)
Catalogue peptide; min. 95% purity
Formula:C147H246N41O40P3Peso molecolare:3,320.78 g/molRef: 3D-VAC-00525
Prodotto fuori produzioneNeurotrophic Factor for Retinal Cholinergic Neurons
Catalogue peptide; min. 95% purity
Formula:C53H84N12O16Peso molecolare:1,145.33 g/molRef: 3D-VAC-00891
Prodotto fuori produzioneα-Gliadin (57-73)
Catalogue peptide; min. 95% purity
Formula:C93H136N22O27Peso molecolare:1,994.25 g/molRef: 3D-VAC-00647
Prodotto fuori produzioneMAP Kinase Substrate
Catalogue peptide; min. 95% purity
Formula:C101H172N30O32Peso molecolare:2,318.66 g/molRef: 3D-VAC-00546
Prodotto fuori produzioneDynorphin A (3-13), porcine
Catalogue peptide; min. 95% purity
Formula:C64H114N22O12Peso molecolare:1,383.76 g/molRef: 3D-VAC-00412
Prodotto fuori produzionebeta-Amyloid/A4 Protein Precursor (APP) (96-110), analog
Catalogue peptide; min. 95% purity
Formula:C81H128N32O19S2Peso molecolare:1,918.25 g/molRef: 3D-VAC-00039
Prodotto fuori produzioneKinase Domain of Insulin Receptor (3)
Catalogue peptide; min. 95% purity
Formula:C72H108N19O27Peso molecolare:1,702.77 g/molRef: 3D-VAC-00772
Prodotto fuori produzione[Tyr1]-pTH (1-34) (rat)
Catalogue peptide; min. 95% purity
Formula:C186H295N55O49S2Peso molecolare:4,149.86 g/molRef: 3D-VAC-00930
Prodotto fuori produzioneRef: 3D-VAC-00916
Prodotto fuori produzioneAngiotensin II Substrate
Catalogue peptide; min. 95% purity
Formula:C50H72N13O15PPeso molecolare:1,126.20 g/molRef: 3D-VAC-00342
Prodotto fuori produzioneRef: 3D-VAC-00430
Prodotto fuori produzioneRef: 3D-VAC-00639
Prodotto fuori produzioneH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ref: 3D-PP47266
Prodotto fuori produzione[Arg3] Substance P
Catalogue peptide; min. 95% purity
Formula:C63H98N20O13SPeso molecolare:1,375.67 g/molRef: 3D-VAC-00678
Prodotto fuori produzione[Cys(Acm)20,31]-EGF (20-31)
Catalogue peptide; min. 95% purity
Formula:C63H98N16O23S3Peso molecolare:1,543.77 g/molRef: 3D-VAC-00265
Prodotto fuori produzioneRef: 3D-VAC-00661
Prodotto fuori produzioneAbz-Val-Ala-Asp-Nva-Arg-Asp-Arg-Gln-EDDnp
CAS:Please enquire for more information about Abz-Val-Ala-Asp-Nva-Arg-Asp-Arg-Gln-EDDnp including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C53H80N20O18Purezza:Min. 95%Peso molecolare:1,285.3 g/molGastrin Releasing Peptide (1-16), human
Catalogue peptide; min. 95% purity
Formula:C74H121N17O20SPeso molecolare:1,600.9 g/molRef: 3D-VAC-00807
Prodotto fuori produzioneAdrenomedullin (1-52), human
Catalogue peptide; min. 95% purity
Formula:C264H406N80O77S3Peso molecolare:6,028.72 g/molRef: 3D-VAC-00919
Prodotto fuori produzioneBAM-12P, Bovine Adrenal Medulla Docosapeptide
Catalogue peptide; min. 95% purity
Formula:C62H97N21O16S1Peso molecolare:1,424.66 g/molRef: 3D-VAC-00878
Prodotto fuori produzioneRef: 3D-VAC-00507
Prodotto fuori produzioneBiotin-Gastrin Releasing Peptide, human
Catalogue peptide; min. 95% purity
Formula:C140H218N40O33S3Peso molecolare:3,085.74 g/molRef: 3D-VAC-00126
Prodotto fuori produzioneADP-Ribosylation Factor 6, ARF6 (2-13)
Catalogue peptide; min. 95% purity
Formula:C60H102N16O17Peso molecolare:1,319.58 g/molRef: 3D-VAC-00433
Prodotto fuori produzioneIntermedin (human)
Catalogue peptide; min. 95% purity
Formula:C219H351N69O66S3Peso molecolare:5,102.84 g/molRef: 3D-VAC-00769
Prodotto fuori produzione[Ala8]-Humanin, [Ala8]-HN, Shna
Catalogue peptide; min. 95% purity
Formula:C119H204N34O32SPeso molecolare:2,655.23 g/molRef: 3D-VAC-00593
Prodotto fuori produzioneAmyloid Dan Protein (1-34)
Catalogue peptide; min. 95% purity
Formula:C185H268N48O51S2Peso molecolare:4,044.63 g/molRef: 3D-VAC-00166
Prodotto fuori produzione[Gln22]-25359-Amyloid (6-40)
Catalogue peptide; min. 95% purity
Formula:C167H258N46O48SPeso molecolare:3,710.26 g/molRef: 3D-VAC-00470
Prodotto fuori produzioneBiotin-Galanin, human
Catalogue peptide; min. 95% purity
Formula:C149H224N44O45SPeso molecolare:3,383.78 g/molRef: 3D-VAC-00093
Prodotto fuori produzionePre-S1 (12-32)
Catalogue peptide; min. 95% purity
Formula:C104H154N26O31SPeso molecolare:2,296.61 g/molRef: 3D-VAC-00599
Prodotto fuori produzione[Tyr27]-a-CGRP (27-37) (canine, mouse, rat)
Catalogue peptide; min. 95% purity
Formula:C54H79N13O17Peso molecolare:1,182.31 g/molRef: 3D-VAC-00929
Prodotto fuori produzione[D-Ala2]-beta-Casomorphin (1-5) amide (bovine)
Catalogue peptide; min. 95% purity
Formula:C28H36N6O6Peso molecolare:552.64 g/molRef: 3D-VAC-00828
Prodotto fuori produzioneBAD (103-127), human
Catalogue peptide; min. 95% purity
Formula:C137H212N42O39SPeso molecolare:3,103.54 g/molRef: 3D-VAC-00617
Prodotto fuori produzioneCC Chemokine Receptor 3 Fragment II, amide
Catalogue peptide; min. 95% purity
Formula:C114H175N25O42S2Peso molecolare:2,631.93 g/molRef: 3D-VAC-00613
Prodotto fuori produzioneAngiotensin II type 1 receptor (181-187), AT1, ATE.
Catalogue peptide; min. 95% purity
Formula:C40H52N10O13Peso molecolare:880.92 g/molRef: 3D-VAC-00215
Prodotto fuori produzioneFluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C43H47FN4O15Purezza:Min. 95%Peso molecolare:878.85 g/mol[Met5,Arg6,7,Val8,Gly9] Enkephalin
Catalogue peptide; min. 95% purity
Formula:C46H71N15O11SPeso molecolare:1,042.24 g/molRef: 3D-VAC-00877
Prodotto fuori produzioneGnT-V (nt38-67)
Catalogue peptide; min. 95% purity
Formula:C54H89N13O13SPeso molecolare:1,159.45 g/molRef: 3D-VAC-00803
Prodotto fuori produzionePannexin-1 Fragment (4515)
Catalogue peptide; min. 95% purity
Formula:C59H104N22O20Peso molecolare:1,441.62 g/molRef: 3D-VAC-00371
Prodotto fuori produzioneNES Topoisomerase II alpha (1017-1028)
Catalogue peptide; min. 95% purity
Formula:C73H117N19O19Peso molecolare:1,564.86 g/molRef: 3D-VAC-00329
Prodotto fuori produzione[Lys0] g-1-MSH, amide
Catalogue peptide; min. 95% purity
Formula:C78H109N23O15SPeso molecolare:1,640.95 g/molRef: 3D-VAC-00562
Prodotto fuori produzione[Ala2] Met-Enkephalin, amide
Catalogue peptide; min. 95% purity
Formula:C28H38N6O6SPeso molecolare:586.72 g/molRef: 3D-VAC-00854
Prodotto fuori produzionebeta-Amyloid (8-38)
Catalogue peptide; min. 95% purity
Formula:C147H227N39O43SPeso molecolare:3,260.75 g/molRef: 3D-VAC-00721
Prodotto fuori produzioneAbz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt
CAS:Please enquire for more information about Abz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C50H63N15O13Purezza:Min. 95%Peso molecolare:1,082.13 g/molRef: 3D-FA110993
Prodotto fuori produzioneBoc-Lys(Tfa)-AMC
CAS:Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.
Formula:C23H28F3N3O6Purezza:Min. 95%Peso molecolare:499.48 g/molRef: 3D-VAC-00884
Prodotto fuori produzioneFas C-Terminal Tripeptide
Catalogue peptide; min. 95% purity
Formula:C16H29N3O6Peso molecolare:359.43 g/molRef: 3D-VAC-00050
Prodotto fuori produzioneα-Neo-Endorphin (1-7)
Catalogue peptide; min. 95% purity
Formula:C40H61N11O9Peso molecolare:840.00 g/molRef: 3D-VAC-00866
Prodotto fuori produzione[D-Pro194]-IL-1 beta (193-195) (human)
Catalogue peptide; min. 95% purity
Formula:C15H28N4O5Peso molecolare:344.41 g/molRef: 3D-VAC-00516
Prodotto fuori produzione[Des-Asp10]Decorsin, Leech
Catalogue peptide; min. 95% purity
Formula:C175H272N54O59S6Peso molecolare:4,268.78 g/molRef: 3D-VAC-00243
Prodotto fuori produzione[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]
Catalogue peptide; min. 95% purity
Formula:C67H110N20O17Peso molecolare:1,467.75 g/molRef: 3D-VAC-00495
Prodotto fuori produzioneSALMF amide 2 (S2)
Catalogue peptide; min. 95% purity
Formula:C59H82N14O18Peso molecolare:1,275.4 g/molRef: 3D-VAC-00720
Prodotto fuori produzione(Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt
CAS:Please enquire for more information about (Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C57H72N14O8Purezza:Min. 95%Peso molecolare:1,081.27 g/molP60c-src Substrate II, Phosphorylated
Catalogue peptide; min. 95% purity
Formula:C33H45N6O12PPeso molecolare:748.8 g/molRef: 3D-VAC-00034
Prodotto fuori produzionep3K truncated, (Lys 58 Lys 60 Lys 63) Ea(54-68)
Catalogue peptide; min. 95% purity
Formula:C59H97N17O19Peso molecolare:1,348.53 g/molRef: 3D-VAC-00383
Prodotto fuori produzioneBiotin-ACTH (1-39), human
Catalogue peptide; min. 95% purity
Formula:C217H322N58O60SPeso molecolare:4,767.47 g/molRef: 3D-VAC-00119
Prodotto fuori produzione[D-Arg0,Hyp2,3,D-Phe7]-Bradykinin
Catalogue peptide; min. 95% purity
Formula:C60H87N19O14Peso molecolare:1,298.48 g/molRef: 3D-VAC-00152
Prodotto fuori produzioneMyelin Oligodendrocyte Glycoprotein (35-55) (mouse, rat) trifluoroacetate
CAS:Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.
Formula:C118H177N35O29S•C2HO2F3Purezza:Min. 95%Colore e forma:PowderPeso molecolare:2,695.98 g/molRef: 3D-FM109206
Prodotto fuori produzioneDesmopressin
CAS:Prodotto controllatoDesmopressin is a synthetic analog of the natural hormone arginine vasopressin. It has been shown to be effective in the treatment of primary nocturnal enuresis, and a number of studies have reported that desmopressin is an effective therapy for idiopathic nocturnal enuresis. Desmopressin also has effects on water permeability, hemolysis, and protein synthesis. It increases the concentration of camp levels in urine and plasma while also inhibiting erythrocyte aggregation. Desmopressin has been shown to be more effective than placebo in women with primary nocturnal enuresis.Formula:C46H64N14O12S2Purezza:Min. 95%Colore e forma:PowderPeso molecolare:1,069.22 g/molRef: 3D-VAC-00483
Prodotto fuori produzionegp100 (178-187)
Catalogue peptide; min. 95% purity
Formula:C42H71N11O14S2Peso molecolare:1,018.23 g/molRef: 3D-VAC-00605
Prodotto fuori produzioneRef: 3D-VAC-00032
Prodotto fuori produzioneBiotin-VIP (human, bovine, porcine, rat)
Catalogue peptide; min. 95% purity
Formula:C157H252N46O44S2Peso molecolare:3,552.17 g/molRef: 3D-VAC-00097
Prodotto fuori produzioneAKT/PKB/Rac-Protein Kinase Substrate
Catalogue peptide; min. 95% purity
Formula:C74H114N28O20Peso molecolare:1,715.91 g/molRef: 3D-VAC-00251
Prodotto fuori produzioneRef: 3D-VAC-00664
Prodotto fuori produzioneIntermedin (rat)
Catalogue peptide; min. 95% purity
Formula:C226H361N75O64S2Peso molecolare:5,216.99 g/molRef: 3D-VAC-00626
Prodotto fuori produzioneFmoc-Glu(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Glu(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purezza:Min. 95%Ref: 3D-FF111727
Prodotto fuori produzioneUru-TK II, Urechistachykinin II
Catalogue peptide; min. 95% purity
Formula:C44H66N14O10SPeso molecolare:983.17 g/molRef: 3D-VAC-00207
Prodotto fuori produzione[Pyr6]-Substance P (6-11)
Catalogue peptide; min. 95% purity
Formula:C36H49N7O7SPeso molecolare:723.91 g/molRef: 3D-VAC-00172
Prodotto fuori produzioneZ-Asp-Gln-Met-Asp-AFC
CAS:Please enquire for more information about Z-Asp-Gln-Met-Asp-AFC including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C36H39F3N6O13SPurezza:Min. 95%Peso molecolare:852.79 g/molRef: 3D-FA110597
Prodotto fuori produzioneCorticostatin, human
Catalogue peptide; min. 95% purity
Formula:C157H261N49O43S6Peso molecolare:3,715.47 g/molRef: 3D-VAC-00788
Prodotto fuori produzioneSubstance P reversed sequence
Catalogue peptide; min. 95% purity
Formula:C63H98N18O13SPeso molecolare:1,347.66 g/molRef: 3D-VAC-00604
Prodotto fuori produzione[Pro34]-Neuropeptide Y, human, rat
Catalogue peptide; min. 95% purity
Formula:C189H285N55O57SPeso molecolare:4,271.67 g/molRef: 3D-VAC-00912
Prodotto fuori produzionePalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH
CAS:Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH is a synthetic cytochalasin that has been shown to have bactericidal activity against Gram-positive bacteria. It inhibits the growth of bacteria by binding to extracellular anions, such as diacylglycerol and aluminium ions. Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH also synergizes with phorbol esters and lipoprotein. This drug has been shown to be effective in treating human serum infections at doses of 100 µg/mL and higher.
Formula:C54H103NO7SPurezza:Min. 95%Peso molecolare:910.46 g/molRef: 3D-FP107899
Prodotto fuori produzioneBiotin-(Cys1,Lys(biotinyl)18)-Calcitonin (human)
Catalogue peptide; min. 95% purity
Formula:C171H254N4O16Peso molecolare:3,870.52 g/molRef: 3D-VAC-00077
Prodotto fuori produzioneTachykinin (111-129) Beta-Prepro (Human)
Catalogue peptide; min. 95% purity
Formula:C96H156N34O31SPeso molecolare:2,314.59 g/molRef: 3D-VAC-00234
Prodotto fuori produzioneRef: 3D-VAC-00566
Prodotto fuori produzioneAllatostatin I (free acid)
Catalogue peptide; min. 95% purity
Formula:C61H94N18O16Peso molecolare:1,335.5 g/molRef: 3D-VAC-00247
Prodotto fuori produzioneBoc-D-Glu-OEt·DCHA
CAS:Prodotto controllatoPlease enquire for more information about Boc-D-Glu-OEt·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C12H21NO6·C12H23NPurezza:Min. 95%Peso molecolare:456.62 g/molRef: 3D-FB111281
Prodotto fuori produzioneBCIP dipotassium
CAS:BCIP (5-bromo-4-chloro-3-indolyl phosphate) dipotassium is a chromogenic substrate commonly used for the detection of the enzymatic activity of alkaline phosphatase. Upon dephosphorylation by alkaline phosphatase, BCIP produces a blue precipitate, which can be easily visualized. This substrate has various uses, including the detection of gene expression in molecular biology, the identification of alkaline phosphatase activity in clinical pathology, and the detection of protein-protein interactions in biochemistry. Its long-term stability in solution makes it a common choice for many applications.
Formula:C8H4BrClK2NO4PPurezza:Min. 98 Area-%Colore e forma:PowderPeso molecolare:402.65 g/molRef: 3D-EB110885
Prodotto fuori produzioneP69 (522-534), M. leprae
Catalogue peptide; min. 95% purity
Formula:C52H84N14O21Peso molecolare:1,241.33 g/molRef: 3D-VAC-00624
Prodotto fuori produzionebeta-Lipotropin (61-64)
Catalogue peptide; min. 95% purity
Formula:C22H26N4O6Peso molecolare:442.48 g/molRef: 3D-VAC-00886
Prodotto fuori produzioneFmoc-Asp(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purezza:Min. 95%Ref: 3D-FF111724
Prodotto fuori produzioneBoc-D-His(Boc)-OH benzene solvate
CAS:Please enquire for more information about Boc-D-His(Boc)-OH benzene solvate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C16H25N3O6Purezza:Min. 95%Colore e forma:SolidPeso molecolare:355.39 g/molRef: 3D-FB111250
Prodotto fuori produzionebeta-Amyloid/A4 Protein Precusor (APP) (319-335)
Catalogue peptide; min. 95% purity
Formula:C86H151N31O26S2Peso molecolare:2,099.48 g/molRef: 3D-VAC-00226
Prodotto fuori produzioneAmyloid Bri Protein (1-34)
Catalogue peptide; min. 95% purity
Formula:C173H273N49O52S2Peso molecolare:3,935.55 g/molRef: 3D-VAC-00168
Prodotto fuori produzione[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat
Catalogue peptide; min. 95% purity
Formula:C171H271N51O54S2Peso molecolare:3,969.50 g/molRef: 3D-VAC-00921
Prodotto fuori produzionebeta-Defensin-3, human
Catalogue peptide; min. 95% purity
Formula:C216H371N75O59S6Peso molecolare:5,155.22 g/molRef: 3D-VAC-00429
Prodotto fuori produzione[Ser25]-PKC (19-36) Substrate
Catalogue peptide; min. 95% purity
Formula:C93H159N35O25Peso molecolare:2,167.52 g/molRef: 3D-VAC-00658
Prodotto fuori produzioneTNF-α(10-36) (human)
Catalogue peptide; min. 95% purity
Formula:C131H211N43O38Peso molecolare:2,996.41 g/molRef: 3D-VAC-00330
Prodotto fuori produzioneDynorphin A (2-13), porcine
Catalogue peptide; min. 95% purity
Formula:C66H117N23O13Peso molecolare:1,440.81 g/molRef: 3D-VAC-00416
Prodotto fuori produzioneα-Neo-Endorphin Analog
Catalogue peptide; min. 95% purity
Formula:C66H102N20O13Peso molecolare:1,383.68 g/molRef: 3D-VAC-00869
Prodotto fuori produzionebeta-Amyloid (7-22)
Catalogue peptide; min. 95% purity
Formula:C88H124N22O26Peso molecolare:2,466 g/molRef: 3D-VAC-00350
Prodotto fuori produzionebeta-Casomorphin (1-3) amide
Catalogue peptide; min. 95% purity
Formula:C23H28N4O4Peso molecolare:424.50 g/molRef: 3D-VAC-00901
Prodotto fuori produzioneGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formula:C215H357N71O67SPeso molecolare:5,040.74 g/molRef: 3D-VAC-00849
Prodotto fuori produzioneα-Mating Factor (1-6)
Catalogue peptide; min. 95% purity
Formula:C45H59N11O8Peso molecolare:882.04 g/molRef: 3D-VAC-00818
Prodotto fuori produzioneγ-TAC4 (30-61)-NH2
Catalogue peptide; min. 95% purity
Formula:C155H242N40O49SPeso molecolare:3,481.96 g/molRef: 3D-VAC-00760
Prodotto fuori produzioneZ-Ile-Glu(OtBu)-Ala-Leu-aldehyde
CAS:Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde, also known as ZILEAL, is a potent immunosuppressant that binds to the Toll-like receptor (TLR) and inhibits NF-κB binding activity. It has been shown to reduce the activation of macrophages by inhibiting the production of proinflammatory cytokines such as tumor necrosis factor alpha (TNFα), IL-1β, and IL-6. This drug has been shown to inhibit HIV replication in vitro and was also found to have an antiviral effect against herpes simplex virus type 1 in vivo. ZILEAL also inhibits dsDNA binding activity, which may have potential applications in cancer treatment.
Formula:C32H50N4O8Purezza:Min. 95%Peso molecolare:618.76 g/molRef: 3D-FI111570
Prodotto fuori produzioneRef: 3D-VAC-00353
Prodotto fuori produzione[Met2]-Deltorphin
Catalogue peptide; min. 95% purity
Formula:C44H62N10O10S2Peso molecolare:955.17 g/molRef: 3D-VAC-00898
Prodotto fuori produzioneRef: 3D-VAC-00392
Prodotto fuori produzioneMyristoylated ADP-Ribosylation Factor 6, myr-ARF6 (2-13)
Catalogue peptide; min. 95% purity
Formula:C74H128N16O18Peso molecolare:1,529.95 g/molRef: 3D-VAC-00162
Prodotto fuori produzioneNps-Val-OH·DCHA
CAS:Prodotto controllatoPlease enquire for more information about Nps-Val-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C11H14N2O4S·C12H23NPurezza:Min. 95%Peso molecolare:451.62 g/molRef: 3D-FN107891
Prodotto fuori produzione[D-Ala2,Leu5,Arg6] Enkephalin
Catalogue peptide; min. 95% purity
Formula:C35H51N9O8Peso molecolare:725.85 g/molRef: 3D-VAC-00837
Prodotto fuori produzioneRef: 3D-VAC-00560
Prodotto fuori produzioneH-D-Phe-pip-Arg-pna acetate
CAS:H-D-Phe-pip-Arg-pna acetate is an allosteric modulator that binds to the active site of thrombin. It inhibits activation of zymogen thrombin by binding to its receptor, thereby inhibiting clotting and coagulation. This compound has been shown to inhibit the activation of pyogenes by preventing the formation of fibrin clots, which are essential for bacterial growth. H-D-Phe-pip-Arg-pna acetate has also been shown to have an inhibitory effect on activated coagulation.
Formula:C27H36N8O5Purezza:Min. 95%Peso molecolare:552.6 g/molAF-16 trifluoroacetate salt
CAS:AF-16 trifluoroacetate salt is a synthetic peptide, which is derived from chemical synthesis with tailored modifications to enhance its stability and efficacy. This compound acts by specifically binding to target receptors or proteins, facilitating the study of biochemical pathways and mechanisms at the molecular level. It is particularly used in biological and biochemical research settings to probe cellular processes, offering insights into protein interactions and signaling pathways.Formula:C71H119N25O25SPurezza:Min. 95%Peso molecolare:1,754.92 g/mol[Tyr27]-pTH (27-48) (human)
Catalogue peptide; min. 95% purity
Formula:C104H159N29O31Peso molecolare:2,311.60 g/molRef: 3D-VAC-00893
Prodotto fuori produzioneFMRF-related peptide, SDPFLRF-NH2
Catalogue peptide; min. 95% purity
Formula:C42H61N11O10Peso molecolare:880.02 g/molRef: 3D-VAC-00707
Prodotto fuori produzioneBiotin-[Tyr0]-Orexin B, mouse, rat
Catalogue peptide; min. 95% purity
Formula:C145H238N48O38S2Peso molecolare:3,325.86 g/molRef: 3D-VAC-00130
Prodotto fuori produzione[Gln11]-beta-Amyloid (1-40)
Catalogue peptide; min. 95% purity
Formula:C194H296N54O57SPeso molecolare:4,328.91 g/molRef: 3D-VAC-00314
Prodotto fuori produzioneParathyroid Hormone (1-34)-Lys(Biotin), human
Catalogue peptide; min. 95% purity
Formula:C197H317N59O54S3Peso molecolare:4,472.26 g/molRef: 3D-VAC-00752
Prodotto fuori produzioneKetolide resistance Peptide MRFFV
Catalogue peptide; min. 95% purity
Formula:C34H50N8O6SPeso molecolare:698.9 g/molRef: 3D-VAC-00610
Prodotto fuori produzione[Ala144]-PLP (139-151) A144-PLP(139-151)
Catalogue peptide; min. 95% purity
Formula:C64H99N19O17Peso molecolare:1,406.62 g/molRef: 3D-VAC-00493
Prodotto fuori produzione[D-Tyr11]-Neurotensin
Catalogue peptide; min. 95% purity
Formula:C78H121N21O20Peso molecolare:1,673 g/molRef: 3D-VAC-00160
Prodotto fuori produzioneα-Melanocyte Stimulating Hormone, acetylated-[D-Val13] (11-13) (MSHa)
Catalogue peptide; min. 95% purity
Formula:C18H33N5O4Peso molecolare:383.49 g/molRef: 3D-VAC-00035
Prodotto fuori produzioneFluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C41H43FN4O14Purezza:Min. 95%Peso molecolare:834.8 g/molRef: 3D-VAC-00256
Prodotto fuori produzioneBiotin-Neurokinin B
Catalogue peptide; min. 95% purity
Formula:C67H87N15O14Peso molecolare:1,326.53 g/molRef: 3D-VAC-00082
Prodotto fuori produzioneTetanus toxin (TT) peptide
Catalogue peptide; min. 95% purity
Formula:C79H120N18O21Peso molecolare:1,657.95 g/molRef: 3D-VAC-00651
Prodotto fuori produzioneBrain injury Derived Neurotrophic Peptide(3) BINP
Catalogue peptide; min. 95% purity
Formula:C62H101N17O19Peso molecolare:1,388.58 g/molBiotin-Bradykinin
Catalogue peptide; min. 95% purity
Formula:C60H87N17O13SPeso molecolare:1,286.53 g/molRef: 3D-VAC-00108
Prodotto fuori produzioneInfluenza HA (529-537)
Catalogue peptide; min. 95% purity
Formula:C41H67N9O13Peso molecolare:894.04 g/molRef: 3D-VAC-00515
Prodotto fuori produzioneZ-Gly-Gly-Trp-OH TFA
CAS:Please enquire for more information about Z-Gly-Gly-Trp-OH TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C23H24N4O6•C2HF3O2Purezza:Min. 95%Peso molecolare:566.48 g/molTNF-α (31-45), human
Catalogue peptide; min. 95% purity
Formula:C69H122N26O22Peso molecolare:1,667.90 g/molRef: 3D-VAC-00681
Prodotto fuori produzioneInfluenza A NP (366-374)
Catalogue peptide; min. 95% purity
Formula:C36H59N11O17S2Peso molecolare:982.06 g/molRef: 3D-VAC-00254
Prodotto fuori produzioneHIV-gp41-Antigenic Peptide 5
Catalogue peptide; min. 95% purity
Formula:C184H282N56O53S2Peso molecolare:4,190.77 g/molRef: 3D-VAC-00698
Prodotto fuori produzioneCalcitonin N-Terminal Flanking Peptide, human
Catalogue peptide; min. 95% purity
Formula:C264H426N74O97SPeso molecolare:6,220.84 g/molRef: 3D-VAC-00238
Prodotto fuori produzioneBiotin-Gastrin (1-17)
Catalogue peptide; min. 95% purity
Formula:C107H140N22O34S2Peso molecolare:2,342.56 g/molRef: 3D-VAC-00088
Prodotto fuori produzione[D-Phe7] a-MSH, amide
Catalogue peptide; min. 95% purity
Formula:C77H109N21O19SPeso molecolare:1,664.92 g/molRef: 3D-VAC-00051
Prodotto fuori produzioneRef: 3D-VAC-00750
Prodotto fuori produzione[Arg0] Met-Enkephalin
Catalogue peptide; min. 95% purity
Formula:C33H47N9O8SPeso molecolare:729.86 g/molRef: 3D-VAC-00699
Prodotto fuori produzioneHypercalcemia Malignancy Factor (1-40)
Catalogue peptide; min. 95% purity
Formula:C180H287N57O48Peso molecolare:4,017.55 g/molRef: 3D-VAC-00260
Prodotto fuori produzioneRef: 3D-VAC-00340
Prodotto fuori produzione[Phe1376]-Fibronectin Fragment (1371-1382)
Catalogue peptide; min. 95% purity
Formula:C63H103N25O19Peso molecolare:1,514.68 g/molRef: 3D-VAC-00679
Prodotto fuori produzioneRef: 3D-VAC-00798
Prodotto fuori produzione
![[Glu2]-TRH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00171.webp&w=3840&q=75)
![[Phe22] Big Endothelin-1 (19-37), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00505.webp&w=3840&q=75)
![[Tyr0]-Hypercalcemia Malignancy Factor (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00857.webp&w=3840&q=75)
![Biotin-[Glu1]-Gastrin I (human) (phosphorylated)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00087.webp&w=3840&q=75)
![[Trp11] Neurotensin (8-13)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00688.webp&w=3840&q=75)
![[Cys3, 6, Tyr8, Pro10]-Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00673.webp&w=3840&q=75)
![Vasoactive Intestinal Contractor [VIC]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00288.webp&w=3840&q=75)
![[Pyr11]-Amyloid beta-Protein (11-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00202.webp&w=3840&q=75)
![[Ile-Ser]-Bradykinin (T-Kinin)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00511.webp&w=3840&q=75)
![[Cit5]-TRAP-5](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00717.webp&w=3840&q=75)
![[Thr46]-Osteocalcin (45-49) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00401.webp&w=3840&q=75)
![[Gln11]-beta-Amyloid (1-28)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00315.webp&w=3840&q=75)
![[Ala4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00021.webp&w=3840&q=75)
![[Tyr1]-pTH (1-34) (rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00930.webp&w=3840&q=75)
![[Arg3] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00678.webp&w=3840&q=75)
![[Cys(Acm)20,31]-EGF (20-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00265.webp&w=3840&q=75)
![[Ala8]-Humanin, [Ala8]-HN, Shna](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00593.webp&w=3840&q=75)
![[Gln22]-25359-Amyloid (6-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00470.webp&w=3840&q=75)
![[Tyr27]-a-CGRP (27-37) (canine, mouse, rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00929.webp&w=3840&q=75)
![[D-Ala2]-beta-Casomorphin (1-5) amide (bovine)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00828.webp&w=3840&q=75)
![[Met5,Arg6,7,Val8,Gly9] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00877.webp&w=3840&q=75)
![[Lys0] g-1-MSH, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00562.webp&w=3840&q=75)
![[Ala2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00854.webp&w=3840&q=75)
![[D-Pro194]-IL-1 beta (193-195) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00516.webp&w=3840&q=75)
![[Des-Asp10]Decorsin, Leech](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00243.webp&w=3840&q=75)
![[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00495.webp&w=3840&q=75)
![[D-Arg0,Hyp2,3,D-Phe7]-Bradykinin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00152.webp&w=3840&q=75)
![[Pyr6]-Substance P (6-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00172.webp&w=3840&q=75)
![[Pro34]-Neuropeptide Y, human, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00912.webp&w=3840&q=75)
![[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00921.webp&w=3840&q=75)
![[Ser25]-PKC (19-36) Substrate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00658.webp&w=3840&q=75)
![[Met2]-Deltorphin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00898.webp&w=3840&q=75)
![[D-Ala2,Leu5,Arg6] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00837.webp&w=3840&q=75)
![[Tyr27]-pTH (27-48) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00893.webp&w=3840&q=75)
![Biotin-[Tyr0]-Orexin B, mouse, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00130.webp&w=3840&q=75)
![[Gln11]-beta-Amyloid (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00314.webp&w=3840&q=75)
![[Ala144]-PLP (139-151) A144-PLP(139-151)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00493.webp&w=3840&q=75)
![[D-Tyr11]-Neurotensin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00160.webp&w=3840&q=75)
![α-Melanocyte Stimulating Hormone, acetylated-[D-Val13] (11-13) (MSHa)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00035.webp&w=3840&q=75)
![[D-Phe7] a-MSH, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00051.webp&w=3840&q=75)
![[Arg0] Met-Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00699.webp&w=3840&q=75)
![[Phe1376]-Fibronectin Fragment (1371-1382)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00679.webp&w=3840&q=75)
