
Peptidi
I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.
Sottocategorie di "Peptidi"
Trovati 30306 prodotti di "Peptidi"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-HEAWITLEK^-OH
Peptide H-HEAWITLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.m-dPEG®8-Azide (Azido-m-dPEG®8)
CAS:<p>m-dPEG®8-Azide (Azido-m-dPEG®8) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®8-Azide (Azido-m-dPEG®8) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Purezza:Min. 95%Peso molecolare:409.48 g/molAzido-dPEG®4-NHS ester
CAS:<p>Azido-dPEG®4-NHS ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®4-NHS ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formula:C15H24N4O8Purezza:Min. 95%Peso molecolare:388.37 g/molδ-MSH
<p>Peptide ÎŽ-MSH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C74H99N21O16SPeso molecolare:1,570.81 g/molFmoc-ß-Ala-OH
CAS:<p>Fmoc-ß-Ala-OH is a synthetic amino acid that is used in the synthesis of cyclic peptides. It has been shown to have receptor activity, such as the ability to bind to an erythrocyte membrane protein. Fmoc-ß-Ala-OH is also able to stimulate macrophage-like cells and polypeptide synthesis. Fmoc-ß-Ala-OH has been synthesized by chemical ligation, followed by purification on an agarose gel. This synthetic amino acid is used as a building block for affinity ligands, which are compounds that bind to specific receptors or other molecules with high specificity and affinity.</p>Formula:C18H17NO4Purezza:Min. 98.0 Area-%Peso molecolare:311.34 g/molH-FFVPPFQQSPR^-OH
Peptide H-FFVPPFQQSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QFYDQALQQAVVDDDANNAK^-OH
Peptide H-QFYDQALQQAVVDDDANNAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.K-252A
CAS:<p>K-252A is an antimicrobial agent that inhibits the growth of bacteria. It binds to the response element in the promoter region of genes and blocks gene transcription, thereby preventing protein synthesis. K-252A has been shown to inhibit the growth of bacteria that are resistant to many other antibiotics, including ampicillin, chloramphenicol, clindamycin, erythromycin, gentamicin and kanamycin. This drug also induces significant up-regulation of cyclic nucleotide phosphodiesterases (PDE) and cytosolic Ca2+ in vitro. K-252A has been shown to cause neuronal death in vitro by inhibiting axonal growth. K-252A also inhibits leukemia inhibitory factor (LIF) from binding to its receptor on mouse lymphocytes.</p>Formula:C27H21N3O5Purezza:Min. 95%Peso molecolare:467.49 g/molUrotensin II (Human) Antiserum
<p>Urotensin II (Human) Antiserum is a research tool for the study of ion channels and receptors. Urotensin II is a peptide that interacts with the G-protein coupled receptor, UTA1. The purified antibody can be used to detect the presence of this peptide in a sample by Western blotting or ELISA. This product is supplied in high purity and has not been shown to react with any other protein.</p>Purezza:Min. 95%H-Arg-Arg-Leu-Ile-Glu-Asp-Ala-Glu-Tyr-Ala-Ala-Arg-Gly-NH2
CAS:This peptide hormone is a member of the lipid-binding proteins. It is a basic protein that has been found to be expressed in human leukemia cells and may have an important function in cellular transformation. The hl-60 cells, treated with this agent, show changes in cell shape and motility. Epidermal growth factor (EGF) receptors are activated by this fatty acid, which leads to an increase in the production of EGF by the cells. This peptide hormone has been shown to bind to the epidermal growth factor receptor and stimulate the production of EGF. Monoclonal antibodies can be used to identify this peptide hormone. The binding sites for this peptide hormone are dinucleotide phosphate or cytosolic proteins. This peptide hormone has been associated with autoimmune diseases such as rheumatoid arthritis and psoriatic arthritis.Formula:C64H106N22O21Purezza:Min. 95%Peso molecolare:1,519.69 g/molH-DLPAPITR^-OH
Peptide H-DLPAPITR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.N-(4-Biphenylacetyl)-Cys(Me)-D-Arg-Phe-N-Phenylethylamide
CAS:N-(4-Biphenylacetyl)-Cys(Me)-D-Arg-Phe-N-Phenylethylamide is an inhibitor of serine proteases. It prevents the breakdown of proteins, which may result in a number of pathologies. N-(4-Biphenylacetyl)-Cys(Me)-D-Arg-Phe-N-Phenylethylamide has been shown to prevent reperfusion injury and proteinuria in mice by inhibiting renal inflammation and oxidative stress. This compound has also been shown to be effective in preventing the development of cancer, for example prostate cancer, by inhibiting angiogenesis, leading to reduced vascularization.Formula:C41H49N7O4SPurezza:Min. 95%Peso molecolare:735.96 g/molMet-MCA
CAS:Met-MCA is a peptide that can be used as an activator, antibody, or receptor. CAS No. 94367-34-7. It is a high purity product with high quality and good stability in salt solution or in PBS (PH 7.4). It inhibits ion channels and has been shown to inhibit the interactions of proteins. Met-MCA can be used as a pharmacological tool for research on protein interactions and ligand/receptor binding.Formula:C15H18N2O3SPurezza:Min. 95%Peso molecolare:306.38 g/molH-VLTEIIASR^-OH
<p>Peptide H-VLTEIIASR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Ser-Leu-Ile-Gly-Arg-Leu-OH
CAS:<p>H-Ser-Leu-Ile-Gly-Arg-Leu-OH is a peptide that is derived from the amino acid sequence of the Protease Activated Receptor (PAR) and has been shown to be an inhibitor of PAR4. It has been shown to inhibit coagulation, myocardial infarct, cytosolic Ca2+, and receptor activity in vitro. H-Ser-Leu-Ile-Gly-Arg-Leu-OH has also been shown to decrease blood pressure in mice by inhibiting cyclase activity and reducing vascular reactivity.</p>Formula:C29H55N9O8Purezza:Min. 95%Peso molecolare:657.82 g/molH-NFLINETAR^-OH
Peptide H-NFLINETAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Neuromedin U8 (Porcine)
CAS:<p>Neuromedin U8 (Porcine) is a peptide that binds to the receptor for Neuromedins. It has been shown to inhibit cell proliferation and induce apoptosis in some cancer cells. Neuromedin U8 has also been shown to have a protective effect on the bowel by inhibiting inflammatory bowel disease. The peptide is also known to be active on other physiological functions and metabolic disorders, such as amide metabolism and hypertrophy, which are due to its conformational properties.</p>Formula:C54H78N16O10Purezza:Min. 95%Peso molecolare:1,111.32 g/molAntipain (Synthetic)
CAS:<p>Antipain (supplied as the HCl salt) is a cytosolic and bound form of antipain. It binds to ATP-binding cassette transporter proteins, which are involved in the transport of substances across cell membranes, and inhibits their enzymatic activity. Antipain 2HCI also has inhibitory properties on enzymes such as DNA polymerase II and pyruvate kinase. It has been shown to have an effect on biochemical properties such as protein synthesis, enzyme activities, and polymerase chain reactions. This drug has been shown to be effective in preventing myocardial infarcts and cellular apoptosis by inhibiting the release of cytochrome c from mitochondria. Antipain 2HCI may also have some anti-inflammatory effects due to its inhibition of prostaglandin synthesis.</p>Formula:C27H44N10O6·2HClPurezza:Min. 95%Peso molecolare:604.7 g/molH-YLWEWASVR^-OH
<p>Peptide H-YLWEWASVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FAGVFHVEK^-OH
<p>Peptide H-FAGVFHVEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Oxyntomodulin, Glucagon-37 (Porcine)
CAS:<p>Oxyntomodulin, a peptide hormone made up of 37 amino acids, is produced and released from gut endocrine L-cells. It has the ability to regulate gastric acids secretion in the gastric oxyntic glands. Oxyntomodulin, Glucagon-37 (Porcine) product is avaiable in the Trifluoroacetate salt form and can be used as an inhibitor of gastric acid secretion and pancreatic enzyme secretion. It has also been shown to reduce food intake and increase energy expenditure in humans. Central injection of oxyntomodulin reduces food intake and weight gain in rodents, suggesting that oxyntomodulin signals food ingestion to hypothalamic appetite-regulating circuits.</p>Formula:C192H295N59O60SPurezza:Min. 95%Peso molecolare:4,421.92 g/molH-VGLPISQ^R-OH
<p>Peptide H-VGLPISQ^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>[Tyr0]-C-Peptide (Human)
CAS:<p>This product is a C-peptide derivative for use in radioimmunoassays. C-peptide is a peptide hormone that is cleaved from proinsulin in the pancreatic beta cells. During glycaemia C-peptide alongside insulin are released by the beta cells. Interestingly C-peptide is not immediately metabolised by the liver and it also has a relatively long half life compared to insulin. Therefore it can be a useful biomarker to monitor beta cell function. Increased levels of C-peptide occurring in patients with insulin resistant type 2 diabetes mellitus, have been associated with macrovascular complications and cardiovascular morbidity. Furthermore C-peptide has been found to prevent endothelial cell reactive oxygen species from being formed thus reducing oxidative stress. This also may lead to anti-inflammatory and anti-apoptotic responses.</p>Formula:C138H220N36O50Purezza:Min. 95%Peso molecolare:3,183.5 g/molH-G^PSLFPLAPSSK^-OH
<p>Peptide H-G^PSLFPLAPSSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Exendin-4 TFA salt
CAS:<p>Synthetic peptide whose sequence was originally isolated from venom derived from the modified salivary glands of the Gila monster (Heloderma suspectum). This product has the potential to be applied as a GLP-1 (Glucagon-Like Peptide-1) Receptor Agonist and is available in the trifluoroacetate salt form.</p>Formula:C184H282N50O60SPurezza:Min. 95%Peso molecolare:4,186.66 g/molFmoc-PFAV
Peptide Fmoc-PFAV is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-TASSYFTNMFATWSPSKARL-NH2
Peptide Ac-TASSYFTNMFATWSPSKARL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-95/aa377 - 391
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,906.3 g/molFmoc-Tyr(tBu)-OH
CAS:<p>Fmoc-Tyr(tBu)-OH is a building block for the synthesis of peptides. It is reacted with tert-butyl alcohol and hydrochloric acid to produce the corresponding Fmoc-protected tyrosine. The Fmoc group can be removed by treatment with dicyclohexylcarbodiimide and tert-butyl alcohol, followed by saponification in aqueous base. The morphologies of the resulting free amino acids are determined by their solubility in organic solvents such as chloroform or ethyl acetate, as well as in water.</p>Formula:C28H29NO5Purezza:Min. 98.0 Area-%Peso molecolare:459.53 g/molDoxorubicin hydrochloride
CAS:Doxorubicin is a cytotoxic drug that belongs to the class of anthracyclines. It is used as an anticancer agent and in the treatment of various types of cancer. Doxorubicin has been shown to inhibit glucose uptake by cells, which may be due to its ability to form disulfide bonds with proteins. Doxorubicin also binds to iron-sulfur clusters, causing cell lysis, which may lead to tumor necrosis. In vitro assays have shown that doxorubicin inhibits drug transporter function, leading to reduced cellular uptake of drugs.Formula:C27H29NO11•HClPurezza:Min. 95%Peso molecolare:579.98 g/molBoc-D-Trp(CHO)-OH
CAS:<p>Boc-D-Trp(CHO)-OH is a synthetic peptide. It is an activator of ion channels and has been used to study the interactions between ligands and receptors. This product is suitable for life science, cell biology, pharmacology, and other research applications. Boc-D-Trp(CHO)-OH can be used as a research tool in studying protein interactions and receptor functions.</p>Formula:C17H20N2O5Purezza:Min. 95%Peso molecolare:332.35 g/molEchistatin
CAS:<p>Echistatin is a natural product isolated from the venom of the snake Echis carinatus. It is an inhibitor of protein synthesis that binds to the integrin receptor and blocks the binding of extracellular matrix proteins, leading to cell death. Echistatin has been shown to inhibit the proliferation of human osteosarcoma cells in vitro and induce neuronal death in vivo. In addition, it has been shown to be effective against human breast cancer cells that express high levels of integrins. The disulfide bond in echistatin may represent a potential anticancer agent due to its ability to form covalent bonds with other molecules such as DNA, RNA, or proteins.</p>Formula:C217H341N71O74S9Purezza:Min. 95%Peso molecolare:5,417.14 g/molFmoc-D-Glu(OtBu)-OH
CAS:<p>Fmoc-D-Glu(OtBu)-OH is an amino acid that is used in peptide synthesis. It can be used as a building block or as a tool for peptide synthesis. Fmoc-D-Glu(OtBu)-OH has the following characteristics:</p>Formula:C24H27NO6Purezza:Min. 95%Peso molecolare:425.49 g/molDSTYSLSSTLTLSK
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C64H107N15O26Peso molecolare:1,616.64 g/molH-IVGGWECEK^-OH
Peptide H-IVGGWECEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.ANP (3-28) (Human, Porcine, Bovine)
CAS:<p>ANP (3-28) is a peptide that belongs to the class of activators. It is a ligand for the G protein-coupled receptor ANP receptor and also binds to the N-type calcium channel. ANP (3-28) has been shown to activate potassium channels in cell culture, and it has been used as a research tool for studying ion channels. This peptide has also been found to inhibit the growth of various types of cancer cells, including those from breast, prostate, and colon cancers.</p>Formula:C118H187N43O36S3Purezza:Min. 95%Peso molecolare:2,880.26 g/molH-AKPEAPGEDASPEEL^SRYYASL^RHYL^NLVTRQRY-NH2
H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C190H288N54O57Peso molecolare:4,240.7 g/molHepcidin (Rat) (Bulk)
Consisting of the following disulfide Bonds: Cys7-Cys23, Cys10-Cys13, Cys11-Cys19, Cys14-Cys22, this product is a rat Hepcidin peptide hormone available as a Trifluoroacetate Salt. Hepcidin is a hormone that regulates iron homeostasis in mammals. It is synthesized by hepatocytes and released into the blood, where it binds to ferroportin, expressed on the surface of cells lining the small intestine. Through binding to ferroportin, Hepcidin inhibits ferroportin's function and prevents iron from being absorbed from the gut.Formula:C111H169N31O35S8Purezza:Min. 95%Peso molecolare:2,712.2 g/molH-HSQGTFTSDYSK^YLDSRRAQDFVQWLMNTKR^NRNNIA-OH
H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C192H295N61O60SPeso molecolare:4,449.9 g/molH-Phe-Leu-Leu-Arg-Asn-OH
CAS:H-Phe-Leu-Leu-Arg-Asn-OH is a β-amino acid that has been shown to have antioxidant properties. It acts as a competitive inhibitor of the enzyme collagenase and has been shown to inhibit the development of atherosclerotic lesions in mice. The amide form of H-Phe-Leu-Leu-Arg-Asn has also been shown to have site specific activity on ventricular myocardium cells, which may be related to its ability to induce cytosolic calcium release. HPLR also has protease activity that can be inhibited by urea nitrogen and β amino acid. Basophilic leukemia cells produce HPLR at high levels and it is thought that this is due to an increased requirement for the production of collagen in these cells. HPLR has been shown to activate thrombin receptors, which are found on the surface of platelets and endothelial cells. Activated thrombinFormula:C31H51N9O7Purezza:Min. 95%Peso molecolare:661.81 g/molBz-L-Arg-pNA·HCl
CAS:Bz-L-Arg-pNA • HCl is a protease inhibitor. It is a competitive inhibitor of bovine pancreatic trypsin, chymotrypsin, and elastase. Bz-L-Arg-pNA • HCl has also been shown to inhibit the growth of cancer cells in culture and to induce apoptosis. Bz-L-Arg-pNA • HCl binds to the active site of cathepsin and thiol proteases, inhibiting their activity by blocking peptide bond hydrolysis. This drug has been shown to inhibit proteolytic activation of proinflammatory cytokines such as IL1β, IL6, IL8, and TNFα.Formula:C19H22N6O4•HCIPurezza:Min. 95%Peso molecolare:434.88 g/molAc-VQIVYK-OH
Peptide Ac-VQIVYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Phosphoramidon
CAS:<p>Phosphoramidon is a phosphonate compound that inhibits the binding of two enzymes, cholinesterase and butyrylcholinesterase. It has been shown to cause a bronchoconstrictor response in mice, inhibit mesenteric enzyme activities, and inhibit cardiac enzyme activity in rats. Phosphoramidon is used as an experimental drug for treatment of myocardial infarcts. It also has an effect on the central nervous system by acting on neurokinin-1 receptors and kappa-opioid receptors.<br>Phosphoramidon is a monosodium salt with biochemical properties similar to those of other members of this class of drugs.</p>Formula:C23H32N3O10P•2Na•2H20Purezza:Min. 95%Peso molecolare:623.5 g/molH-NAVEVLKR^-OH
Peptide H-NAVEVLKR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Omega-Conotoxin MVIIC
CAS:<p>Omega-Conotoxin MVIIC is a peptide that binds to the nicotinic acetylcholine receptor and activates it, leading to inhibition of neurotransmitter release. It is used as a research tool for studying the pharmacology of ion channels and their ligands. Omega-Conotoxin MVIIC is purified from Conus magus venom. The peptide has been shown to be an inhibitor of potassium channels in rat cortical neurons. CONOTOXINS are small peptides that bind to the nicotinic acetylcholine receptor and activate it, leading to inhibition of neurotransmitter release. They are used as research tools for studying the pharmacology of ion channels and their ligands. CONOTOXINS are purified from Conus magus venom. The peptide has been shown to be an inhibitor of potassium channels in rat cortical neurons.END> END></p>Formula:C106H178N40O32S7Purezza:Min. 95%Peso molecolare:2,749.3 g/molgp100 (86-95)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>CMVpp65 - 61 (FMHVTLGSDVEEDLT)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,692.9 g/molBNP-45 (Rat)
CAS:<p>BNP-45 is a peptide that binds to the beta-subunit of the Na+/K+ ATPase, inhibiting its activity. It is a potent inhibitor of the enzyme and has been used in research as a tool to study ion channels and receptor activation.<br> BNP-45 has been shown to inhibit ion-channel activity by binding to the beta subunit of the Na+/K+ ATPase. This inhibition leads to an increase in intracellular sodium and calcium levels, which may result in a variety of physiological effects.</p>Formula:C213H349N71O65S3Purezza:Min. 95%Peso molecolare:5,040.7 g/molBoc-D-Leu-OH • H2O
CAS:<p>Boc-D-Leu-OH • H2O is an intramolecular hydrogen. It has a helical structure and forms hydrogen bonds with other molecules. Boc-D-Leu-OH • H2O is a cyclic peptide with a hydrophobic side chain and a hydrophilic head group. The peptide has been shown to have antimicrobial activity in the biliary and intestinal tract, as well as chronic pain relief properties. Boc-D-Leu-OH • H2O was found to be effective in animal studies for neuropathic pain, which may be due to its amide structure. A silico analysis revealed that the drug substance had a high binding affinity for the mu opioid receptor and could potentially be used to treat chronic pain caused by inflammation.</p>Formula:C11H21NO4•H2OPurezza:Min. 95%Peso molecolare:249.31 g/molZ-Leu-Leu-Glu-MCA
CAS:<p>L-Leu-Leu-Glu-MCA is a research tool that activates the receptor. It is a ligand that binds to the receptor, activating it. L-Leu-Leu-Glu-MCA is a small molecule that has been shown to be an antagonist of ion channels in cell biology. It has been shown to inhibit protein interactions and peptide synthesis by inhibiting the binding of ATP. L-Leu-Leu-Glu-MCA also acts as an inhibitor of ion channels and high purity protein interactions, which may be due to its competitive inhibition of ATP binding. Ligands are used in pharmacology for studying protein interactions or inhibiting enzyme activity. The CAS No. for this compound is 348086-66-8.</p>Formula:C35H44N4O9Purezza:Min. 95%Peso molecolare:664.75 g/molBoc-Asn-OH
CAS:<p>Boc-Asn-OH is a glycopeptide that has a basic structure. It is soluble in water and hydrochloric acid. Boc-Asn-OH has been shown to have antibacterial activity against methicillin-resistant Staphylococcus aureus (MRSA) and Clostridium perfringens, as well as good solubility in organic solvents such as chloroform and acetonitrile. Preparative high performance liquid chromatography (HPLC) of Boc-Asn-OH reveals an amide, toxicity studies, proton, oligosaccharides, disulfide bond, thp-1 cells, conformational properties, esters hydrochloride.</p>Formula:C10H19NO4Purezza:Min. 95%Peso molecolare:232.23 g/mol[D-Arg1,D-Phe5,D-Trp7,9,Leu11]-Substance P
CAS:Substance P is a neuropeptide that belongs to the Feeding Regulatory Peptides family. It is synthesized in the hypothalamus and secreted by neurons in the spinal cord, brainstem, and gut. Substance P has been shown to regulate feeding behavior through its interaction with opioid receptors and the release of other neurotransmitters. The synthetic form of this peptide has been shown to reduce body fat in animal models and increased sensitivity to insulin in diabetic patients. This peptide also reduces camp levels in rats, which may be due to its ability to stimulate secretion of camp from pancreatic cells.Formula:C79H109N19O12Purezza:Min. 95%Peso molecolare:1,516.87 g/molCamostat Mesilate
CAS:<p>Camostat mesilate is a prodrug that is metabolized to the active form, pemastatin. It is used for the treatment of bowel disease and squamous cell carcinoma. Camostat mesilate inhibits the TNF-α receptor by binding to its response element in vitro and in vivo. The biological properties of camostat mesilate are due to its ability to inhibit TNF-α production by binding to the TNF-α receptor, thereby preventing activation of transcription factors such as nuclear factor kappa B (NFκB). In vitro assays have shown that camostat mesilate induces apoptosis in human carcinoma cell lines through inhibition of growth factor-β1. This drug has also been shown to be effective in treating viral infections, including HIV and herpes zoster.</p>Formula:C20H22N4O5•CH3SO3HPurezza:Min. 95%Peso molecolare:494.5 g/molH-IGGHGAEYGAEALER^-OH
Peptide H-IGGHGAEYGAEALER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LHGGSPWPPCQYR^-OH
Peptide H-LHGGSPWPPCQYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Gly-Leu-Gly-OH
CAS:Gly-Leu-Gly is a peptide that has a conformation in which the side chain of the amino acid glycine is attached to the alpha-carbon atom of the amino acid leucine. It is a labile molecule, meaning that it can react with other molecules or break down spontaneously. Gly-Leu-Gly is also called glycylleucine. This peptide has been found to have protonation properties that depend on temperature and kinetic energy. The carbonyl group of this peptide interacts with other molecules by donating or accepting electrons. In addition, this compound can be analyzed using spectrometers and gas chromatographs.Formula:C10H19N3O4Peso molecolare:245.28 g/molH-Val-Lys-Gly-Ile-Leu-Ser-NH2
CAS:<p>H-Val-Lys-Gly-Ile-Leu-Ser-NH2 is a biologically active peptide. It is a peptide that is derived from the amino acid sequence of protease activated receptor 2 (PAR2) and has been shown to induce coagulation. This peptide has also been shown to have cardiovascular effects, such as reducing blood pressure, and may be useful in the treatment of hypertension.</p>Formula:C28H54N8O7Purezza:Min. 95%Peso molecolare:614.79 g/molH-VLIVPQNFVVAAR^-OH
<p>Peptide H-VLIVPQNFVVAAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CQLINTNGSWHINCK-NH2
Peptide Ac-CQLINTNGSWHINCK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IPAMVVDR^-OH
<p>Peptide H-IPAMVVDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-NIQLINTNGSWHINST-NH2
Peptide Ac-NIQLINTNGSWHINST-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-Leu-Leu-Met-H (Aldehyde)
CAS:<p>Ac-Leu-Leu-Met-H (Aldehyde) is a tetrazolium dye that is used as a biological stain for the detection of bacteria in infectious diseases. It binds to toll-like receptor 4 on macrophages and other cells, which triggers a cascade of events leading to bacterial cell lysis. Aldehyde also has been shown to be an autophagy inducer and can cause neuronal death when administered in high doses.</p>Formula:C19H35N3O4SPurezza:Min. 95%Peso molecolare:401.57 g/molH-YGNGVWIGR^-OH
Peptide H-YGNGVWIGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CGRP (Rat)
CAS:<p>CGRP (Rat) product with the disulfide Bonds: Cys2-Cys7 and available as a 0.1 mg vial. CGRP is the calcitonin gene-related peptide (CGRP), a neuropeptide that plays an important role in the regulation of vascular tone and blood flow, as well as pain perception, inflammation, and neurogenic inflammation. It is a potent vasodilator and has been implicated in a wide range of physiological and pathophysiological processes.<br>This product has the potential for use in the study of the physiological and pathological roles of CGRP and to investigate the effects of CGRP on blood vessels, neurons, and other tissues. It has also been used to develop models of migraine headaches and other conditions associated with CGRP dysfunction.</p>Formula:C162H262N50O52S2Purezza:Min. 95%Peso molecolare:3,806.2 g/molpE-LYENKPRRP^YIL^
pE-LYENKPRRPYIL is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C73H116N20O18Peso molecolare:1,561.84 g/molH-LNNISIIGPLDMK^-OH
Peptide H-LNNISIIGPLDMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.[Arg8]-Vasopressin
CAS:<p>Vasopressin is a peptide antidiuretic hormone, originating from the hypothalamus, that regulates water balance in the body. It is also known as arginine vasopressin or antidiuretic hormone (ADH). The clinical efficacy of vasopressin has been evaluated using in vitro methods on mouse monoclonal antibody production cells, blood sampling, and microdialysis probes for monitoring blood pressure. This product is available in the salt form: Acetate.</p>Formula:C46H65N15O12S2Purezza:Min. 95%Peso molecolare:1,084.25 g/molH-GQSIQPFISR^-OH
<p>Peptide H-GQSIQPFISR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>(3,5-Difluorophenylacetyl)-Ala-Phg-OtBu
CAS:<p>(3,5-Difluorophenylacetyl)-Ala-Phg-OtBu is a secretase inhibitor that inhibits the enzyme that cleaves amyloid precursor protein (APP) to release beta-amyloid. It has been shown to prevent the formation of plaques in the brain and may be used to treat Alzheimer's disease. (3,5-Difluorophenylacetyl)-Ala-Phg-OtBu has also been shown to inhibit the production of tumor necrosis factor alpha (TNFα), which is involved in inflammation and carcinogenesis. The drug has been shown to reduce myocardial infarct size by preventing cardiac cell death and reducing inflammation following a heart attack. It is also active against multiple types of cancer cells, including carcinoma cell lines and multidrug resistant cells.</p>Formula:C23H26N2O4F2Purezza:Min. 95%Peso molecolare:432.47 g/molAc-Leu-Leu-Nle-H (Aldehyde)
CAS:<p>Ac-Leu-Leu-Nle-H (Aldehyde) is a Toll-like receptor ligand that is active against bowel disease. Aldehyde has been shown to have chemotherapeutic effects in vitro and in vivo, even at low doses. It also inhibits the growth of certain cancer cells by inducing apoptosis, which may be due to its ability to activate the nuclear factor kappa B/Toll-like receptor pathway. This agent has been shown to bind to DNA, inhibit transcription, and induce programmed cell death. Aldehyde also binds to proteins that are involved in protein synthesis and cell division. These properties make it useful for the treatment of infectious diseases and cancer.</p>Formula:C20H37N3O4Purezza:Min. 95%Peso molecolare:383.54 g/molH-QLSESQVK^-OH
Peptide H-QLSESQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-Lys(Z)-OH
CAS:<p>Boc-Lys(Z)-OH is an amino acid that is used as a building block for peptide synthesis. It can be used to synthesize Boc-protected L-amino acids, which are useful in the chemical synthesis of peptides and proteins.</p>Formula:C19H28N2O6Purezza:Min. 95%Peso molecolare:380.44 g/molAc-Nle-Cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2
CAS:<p>Ac-Nle-Cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2, also known as cycloastragenol, is a synthetic cyclic peptide that inhibits the activity of adipose β3 adrenergic receptors, leading to reduced fat accumulation. Cycloastragenol has been shown to inhibit the formation of atherosclerotic lesions in mice and may have antiatherogenic effects. It also has been shown to inhibit tumor growth in some skin cancer models and has immunosuppressive effects.</p>Formula:C50H69N15O9Purezza:Min. 95%Peso molecolare:1,024.2 g/molH-CSCSSLMDKECVY^FCHLDIIW^VNTPEHVVPYGL^GSPRS-OH
<p>H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Fmoc-Phe-OH
CAS:<p>Fmoc-Phe-OH is a natural compound that has been shown to have antimicrobial properties. The biological properties of Fmoc-Phe-OH are not well understood, but it has been shown to have anticancer effects in some cases and to inhibit axonal growth when combined with the protein laminin. Fmoc-Phe-OH can be synthesized by the reaction of pheine with trifluoroacetic acid followed by treatment with h9c2 cells. The analytical method for determining the concentration of Fmoc-Phe-OH is based on intramolecular hydrogen exchange between hydrogen atoms on the amide group and hydrogens on neighboring methylene groups. This process releases heat, which is detected by a thermometer.<br>END></p>Formula:C24H21NO4Purezza:Min. 98.0 Area-%Peso molecolare:387.44 g/molIberiotoxin
CAS:<p>Iberiotoxin a synthetic scorpion toxin sourced from the Buthus tamulus scorpion, has disufide bonds formed between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35. This prodict can be used as a Ca2+-Activated K+ Channel Blocker (Maxi-K+ Channel Blocker). This peptide can be used in pharmacological studies to investigate the effects of Iberiotoxin on various ion channels and receptors.</p>Formula:C179H274N50O55S7Purezza:Min. 95%Peso molecolare:4,230.8 g/molBoc-D-Ile-OH • 1/2 H2O
CAS:<p>Boc-D-Ile-OH is a cyclohexanone that can be used in peptide synthesis. It has been shown to have affinity for the Tools for Peptide Synthesis and is able to activate primary tumors with metastasis. Boc-D-Ile-OH has been shown to have kinetic parameters, and its pharmacophores are characterized by an organic chemistry approach. This compound is a serine protease inhibitor that blocks the activity of other serine proteases such as chymotrypsin and trypsin.</p>Formula:C13H21NO4H2OPurezza:Min. 95%Peso molecolare:240.3 g/molH-ALLFIPR^-OH
Peptide H-ALLFIPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cyclo(Arg-Ala-Asp-D-Phe-Cys)
CAS:<p>Cyclo(Arg-Ala-Asp-D-Phe-Cys) is a peptide macrocycle with the amino acid sequence Arg-Ala-Asp-D-Phe-Cys. RGD peptides are biologically active peptides that have been shown to be useful in the treatment of various conditions, including angiogenesis and cancer. Cyclo(Arg-Ala-Asp-D-Phe-Cys) is a cyclic peptide composed of nine amino acids, where each amino acid has one chiral center. This results in two possible stereoisomers (mirror images) for the molecule. The biological activity of this compound has yet to be fully determined.</p>Formula:C25H36N8O7SPurezza:Min. 95%Peso molecolare:592.67 g/molH-TYLPAVDEK^-OH
<p>Peptide H-TYLPAVDEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Acetyl-Myelin Basic Protein (Human, Porcine, Rat, 1-11)
CAS:<p>The myelin sheath which is located in both the Central Nervous System (CNS) and the Peripheral Nervous System is crucial for neural insulation and the salutatory conduction of nerve impulses. When this myelin sheath is destroyed neurodegeneration and conduction failure occur. This can be observed in demyelinating diseases in the CNS such as: acute disseminated encephalomyelitis and multiple sclerosis and within the PNS: Guillain–Barré syndrome and Charcot–Marie–Tooth disease.<br>Myelin Basic Protein (MBP) from which this product is derived is the second most abundant protein in myelin. It has been found to be an intrinsically disordered protein and depending on the environmental conditions it can change its conformation. It also folds into ⍺-helical structures which allow MBP to bind tightly to lipid bilayer surfaces. MBP also interacts with other proteins, namely cytoskeletal proteins and calmodulin and may be involved in signalling pathways.<br>Although more research needs to be carried out, it is thought that MBP significantly contributes to the pathogenesis of multiple sclerosis. As MBP is an autoantigen it can be recognized and cleaved by autoantibodies and is a substrate for the immunoproteasome. Additional research has found that post-translational modifications of MBP such as the removal of arginine are increased in and may be involved in the pathogenesis of multiple sclerosis. Therefore this protein derived from MBP can be used to mimic Neurodegenerative disease phenotypes in research and animal models.</p>Formula:C52H88N22O17Purezza:Min. 95%Peso molecolare:1,293.42 g/molLCBiot-KPVSKMRMATPLLMQAL-OH
<p>Peptide LCBiot-KPVSKMRMATPLLMQAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Asp-Glu-Asp-Glu
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C18H26N4O13Peso molecolare:506.42 g/molLeupeptin hemisulphate salt monohydrate (Synthetic)
CAS:Leupeptin is a naturally occurring protease inhibitor that has been synthetically produced for use as an experimental tool. Leupeptin inhibits the activity of basic proteins and enzymes by binding to them at the active site, preventing their access to substrate. This inhibition can be reversed with reducing agents (e.g., dithiothreitol). Leupeptin has been shown to inhibit neuronal death during anoxia in experimental models and has also been shown to have neurotrophic effects, which may be due to its ability to prevent protein aggregation.Formula:C20H38N6O4•(H2SO4)0•H2OPurezza:Min. 95%Peso molecolare:493.61 g/molTAT (47-57) TFA salt
CAS:<p>Amino acids 47-57 of the Human Immunodeficiency Virus (HIV) viral coat trans-activator of transcription protein (TAT protein). TAT is a cell penetrating peptide meaning it has the ability to transport itself across cell membranes and into a cell's nucleus independently. Cell penetrating peptides (CPPs) can be used to carry other molecules into the cell and therefore can be used in many applications. Such applications may include: drug delivery, where small drug peptides or nucleic acids can be delivered into target cells or where CPPs are conjugated to imaging agents such as fluorescent dyes or radiolabeled molecules they can be used for in vivo or in vitro imaging in diagnostics. <br>This product is available as a trifluroacetate salt.</p>Formula:C64H118N32O14Purezza:Min. 95%Peso molecolare:1,559.86 g/molHXB2 gag NO-83/aa329 - 343
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,514.9 g/molH-ANELLINVK^-OH
Peptide H-ANELLINVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Stearyl-WEAALAEALAEALAEHLAEALAEALEALAA-OH
Peptide H-Stearyl-WEAALAEALAEALAEHLAEALAEALEALAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Ser-Phe-Leu-Leu-Arg-Asn-NH2
CAS:<p>This is a monoclonal antibody that binds to the alpha-integrin receptor. The alpha-integrin receptor is an integrin that is involved in cell adhesion and migration, as well as the activation of several signaling pathways. This antibody has been shown to inhibit the binding of alpha-integrins to phospholipid membranes, which may be due to inhibition of protein kinase C (PKC). This antibody also inhibits thrombin receptor activation and dextran sulfate-induced cytosolic calcium mobilization.</p>Formula:C34H57N11O8Purezza:Min. 95%Peso molecolare:747.9 g/molCpp-AAF-pAb
CAS:<p>Cpp-AAF-pAb is a synthetic peptide that corresponds to the amino acid sequence of the C terminus of human basic fibroblast growth factor (bFGF) and has been shown to have a variety of effects on cells. It has been used in cell culture studies to measure the effect of bFGF on renal blood flow, which is an important marker for kidney disease. In addition, this peptide inhibits tumor cell growth and has antinociceptive properties in rats. The inhibition of tumor cell growth may be due to its ability to inhibit metalloendopeptidases and polyclonal antibodies.</p>Formula:C32H36N4O7Purezza:Min. 95%Peso molecolare:588.67 g/molH-CSCSSWLDKECVY^FCHLDIIW^VNTPEQTAPYGL^GNPP-OH
H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-GNPESSFNDENLR^-OH
Peptide H-GNPESSFNDENLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YPIKPEAPGEDASPEEL^NRYYASL^RHYL^NLVTRQR-OH
Peptide H-YPIKPEAPGEDASPEEL^NRYYASL^RHYL^NLVTRQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALLESSLR^QA-OH
Peptide H-ALLESSLR^QA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IGGIGTVPVGR^-OH
<p>Peptide H-IGGIGTVPVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>MOG (Rat, Mouse, 35-55)
CAS:<p>Amino acids 35-55 derived from the Immunogenic Myelin Oligodendrocyte protein (MOG). Produced by oligodendrocytes, MOG is an integral part of the oligodendrocyte surface membrane, located in the central nervous system (CNS) and plays an important role in the maintenance and disintegration of the myelin sheath. Unique within their immunoglobulin superfamily, MOG is composed of a transmembrane hydrophobic domain, an extracellular immunoglobulin variable (IgV) domain, a short cytoplasmic loop and within the membrane bilayer there is a second hydrophobic region and after this, a cytoplasmic end. In addition to 218 amino acids of the mature MOG protein, it contains a 29 amino acids long signal peptide.<br>MOG has not only been found to be expressed in the CNS but also at low levels in the peripheral nervous system. Generally MOG is expressed during myelination and functions to maintain the myelin sheath’s structurally integrity through mediating interactions between the myelin and the immune system. This is possible due to its adhesion characteristics and its external location which makes it accessible to antibodies and T-cells. Furthermore is has been suggested that MOG is involved in regulating oligodendrocyte microtubule stability and it can be used as a differentiation marker for oligodendrocyte maturation.Myelin forms a lipid layer around neurons which insulates them. MOG has immunodmainant epitopes: 1-22; 35-55 and 92-106 and this is located at the dimer interface which is formed by MOG IgV domains forming a dimer. These MOG epitopes are recognized by encepalitogenic T cells as foreign antigens. As a result demyelination occurs and this happens in the disease state of Multiple Sclerosis (MS).<br>As MOG is associated with inflammatory demyelinating diseases within the CNS such as neuromyelitis optica spectrum disorders and acute disseminated encephalomyelitis, this MOG (35-55) product can be used to induce these disease states in animal models.<br>One-Letter Formula: MEVGWYRSPFSRVVHLYRNGK</p>Formula:C118H177N35O29SPurezza:Min. 95%Peso molecolare:2,581.95 g/molMyelin Basic Protein (87-99)
CAS:<p>The myelin sheath which is located in both the Central Nervous System (CNS) and the Peripheral Nervous System is crucial for neural insulation and the salutatory conduction of nerve impulses. When this myelin sheath is destroyed neurodegeneration and conduction failure occur. This can be observed in demyelinating diseases in the CNS such as: acute disseminated encephalomyelitis and multiple sclerosis and within the PNS: Guillain–Barré syndrome and Charcot–Marie–Tooth disease.<br>Myelin Basic Protein (MBP) from which this product is derived is the second most abundant protein in myelin. It has been found to be an intrinsically disordered protein and depending on the environmental conditions it can change its conformation. It also folds into ⍺-helical structures which allow MBP to bind tightly to lipid bilayer surfaces. MBP also interacts with other proteins, namely cytoskeletal proteins and calmodulin and may be involved in signalling pathways.<br>Although more research needs to be carried out, it is thought that MBP significantly contributes to the pathogenesis of multiple sclerosis. As MBP is an autoantigen it can be recognized and cleaved by autoantibodies and is a substrate for the immunoproteasome. Additional research has found that post-translational modifications of MBP such as the removal of arginine are increased in and may be involved in the pathogenesis of multiple sclerosis. Therefore this protein derived from MBP can be used to mimic Neurodegenerative disease phenotypes in research and animal models.</p>Formula:C74H114N20O17Purezza:Min. 95%Peso molecolare:1,555.86 g/molSuc-Phe-Ala-Ala-Phe-pNA
CAS:<p>Suc-Phe-Ala-Ala-Phe-pNA is an amino acid that is a substrate for the serine protease myroilysin. It is used in biochemical research to investigate the physiological function of myroilysin. Suc-Phe-Ala-Ala-Phe-pNA has been shown to be an irreversible inhibitor of myroilysin and inhibits enzyme catalysis.</p>Formula:C34H38N6O9Purezza:Min. 95%Peso molecolare:674.70 g/molHepcidin-22 (Human)
CAS:<p>Hepcidin product containing the disulfide Bonds: Cys4-Cys20, Cys7-Cys10, Cys8-Cys16, and Cys11-Cys19 and available in the trifluoroacetate salt form. Hepcidin-22 is a variant of the peptide hormone hepcidin-25, which plays an important role in the regulation of iron metabolism in the body. Hepcidin is produced by the liver and is secreted into the bloodstream.<br>Hepcidin binds to ferroportin, a protein that facilitates the export of iron from cells into the bloodstream, and to inhibit its activity.<br>The biological significance of hepcidin-22 is still being studied, but it may play a role in the regulation of iron metabolism in certain situations, such as inflammation or certain disease states. Both hepcidin-22 and hepcidin-25 are targets for the development of treatments for iron-related disorders, such as anemia of chronic disease and hemochromatosis.</p>Formula:C99H151N29O25S9Purezza:Min. 95%Peso molecolare:2,436.06 g/molBQ-610
CAS:<p>BQ-610 is a drug that has been shown to improve brain functions and energy metabolism. It also inhibits the transmission of pain signals in the mesenteric region of rats by blocking voltage-dependent calcium channels. BQ-610 is found to suppress the production of endothelin-a receptor, which is an important regulator for many diseases such as infectious diseases, hypertension, and other cardiovascular disorders. The drug has also been shown to reduce oxidative stress by inhibiting cell nuclei and reducing inflammation by inhibiting basic protein synthesis. BQ-610 has been shown to be effective against congestive heart failure in rats by increasing blood flow and improving biochemical properties.</p>Formula:C36H44N6O6Purezza:Min. 95%Peso molecolare:656.79 g/molH-FNWYVDGVEVHNAK^-OH
<p>Peptide H-FNWYVDGVEVHNAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RLAVYQAGAR^-OH
Peptide H-RLAVYQAGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CGRP (Human)
CAS:<p>Human CGRP with a disulfide bond between Cys2-Cys7 and available as a 0.1mg vial. CGRP (calcitonin gene-related peptide) is a 37-amino acid neuropeptide that is found in humans and is widely distributed in the nervous system, particularly in sensory neurons, and is involved in the regulation of vascular tone, blood flow, pain perception, and inflammation. It is a potent vasodilator and has been implicated in the pathophysiology of several vascular disorders, including migraine headaches, cluster headaches, and hypertension.<br>In addition to its vascular effects, human CGRP also has neuroprotective properties and has been investigated as a potential therapeutic agent for various neurological disorders, such as Alzheimer's disease and Parkinson's disease.<br>Human CGRP has been extensively studied as a research tool to investigate its physiological and pathological roles in various tissues and diseases. It has also been targeted by pharmacological agents, such as CGRP antagonists and antibodies, for the treatment of migraine headaches and other conditions associated with CGRP dysfunction.</p>Formula:C163H267N51O49S2Purezza:Min. 95%Peso molecolare:3,789.3 g/molH-Ser-Leu-Ile-Gly-Lys-Val-OH
CAS:<p>H-Ser-Leu-Ile-Gly-Lys-Val-OH is a potent inhibitor of the enzyme soybean trypsin. It is a member of the class of chemical inhibitors that are active against enzymes that regulate cell signaling and inflammatory responses. H-Ser-Leu-Ile-Gly-Lys-Val-OH inhibits toll receptor signaling, which triggers an inflammatory response in cells. This compound has been shown to be effective in animal models for bowel disease and asthma. H Ser Leu Ile Gly Lys Val OH also has low potency, which may be due to its ability to form covalent bonds with other molecules, such as DNA polymerase.</p>Formula:C28H53N7O8Purezza:Min. 95%Peso molecolare:615.76 g/molRibosomal protein L3 peptide (202-222) amide
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C114H182N42O25SPeso molecolare:2,573 g/molH-QGGFLGLSNIK^-OH
<p>Peptide H-QGGFLGLSNIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>TAPI-2 acetate salt
CAS:<p>TAPI-2 is an inhibitor of ADAM-17 (also called TACE) and matrix metalloproteinases (MMPs). It acts as a broad-spectrum inhibitor of these enzymes. TAPI-2 prevents the shedding of tumor necrosis factor-alpha (TNF-α) from cell membranes and can sensitize cancer stem cells to the effects of chemotherapy such as 5-fluorouracil (5-FU) in vitro. It also blocks the phorbol ester-induced shedding of other cell surface proteins like TGF-α and β-amyloid precursor protein.</p>Formula:C19H37N5O5Purezza:Min. 95%Peso molecolare:415.53 g/molFmoc-Lys(Glucitol, Boc)-OH
CAS:<p>Fmoc-Lys(Glucitol, Boc)-OH is a synthetic peptide that acts as an inhibitor of the ion channel TRPC3. It binds to the ligand-binding site of TRPC3, preventing activation by its natural agonist, lysophosphatidic acid (LPA). Fmoc-Lys(Glucitol, Boc)-OH can also be used as a research tool in pharmacology and cell biology. It has been shown to inhibit the growth of cancer cells. This product is available at a purity of > 98%.</p>Formula:C32H44N2O11Purezza:Min. 95%Peso molecolare:632.71 g/molCyclo(Arg-Ala-Asp-D-Phe-Lys)
CAS:<p>Cyclo(Arg-Ala-Asp-D-Phe-Lys) is a cyclic peptide that has been shown to have antiangiogenic properties. It may be used as a linker for the conjugation of drugs to compounds with different target specificities. Cyclo(Arg-Ala-Asp-D-Phe-Lys) is a negative control peptide that has the RGD sequence, which is the most common motif in peptides that are used for cell targeting. This peptide was tested against human ovarian carcinoma and inhibited endothelial cell proliferation and tumor vasculature formation. Cyclo(Arg-Ala-Asp-D-Phe-Lys) also inhibited angiogenesis in vitro and in vivo, suggesting that it may be useful for the treatment of cancer and other diseases involving abnormal blood vessel growth.</p>Formula:C28H43N9O7Purezza:Min. 95%Peso molecolare:617.71 g/molAc-RFAAKAA-OH
Peptide Ac-RFAAKAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Pro-OBzl • Cl
CAS:<p>Pro-OBzl • Cl is a monoclonal antibody that binds to the active site of the ns3 protease, which is an enzyme that is involved in the processing of many proteins. Pro-OBzl • Cl has been shown to inhibit cancer cell growth and to reduce microbial infection by decreasing their ability to produce virulence factors. Pro-OBzl • Cl also has been shown to be effective against viruses such as hepatitis B virus. This drug binds to the receptor on the surface of cells and inhibits viral entry into cells.</p>Formula:C12H15NO2•HCIPurezza:Min. 95%Peso molecolare:241.7 g/molPepstatin A (Purity Higher than 90% by HPLC)
CAS:<p>Pepstatin A is a natural product that inhibits the activity of proteases, particularly chymotrypsin and trypsin. It binds to the active site of these enzymes, blocking access to their substrate. Pepstatin A has been shown to have synergistic effects with other drugs in vitro, such as dapsone and clindamycin. Pepstatin A has inhibitory properties against infectious diseases, including HIV-1 and HIV-2, influenza virus type A (H1N1), herpes simplex virus type 1 (HSV-1), human papilloma virus type 18 (HPV-18), hepatitis C virus (HCV) types 1a and 1b, as well as dengue fever virus. Pepstatin A is also effective in inhibiting polymerase chain reaction amplification of mitochondrial DNA from patients with mitochondrial disorders. The biological sample for this research was obtained from calf thymus tissue. The natural compound pepstatin A has</p>Formula:C34H63N5O9Purezza:Higher Than 90% By Hplc)Peso molecolare:685.89 g/molH-VPQTPLHTSR^-OH
<p>Peptide H-VPQTPLHTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Cyclo(-D-Leu-D-Pro)
CAS:<p>Cyclo(-D-Leu-D-Pro) is a macrolide that inhibits the growth of bacteria. It binds to the 50S ribosomal subunit and prevents the formation of an antibiotic-inhibitor complex with the enzyme cell wall synthesis that is required for cell wall biosynthesis, inhibiting protein synthesis and cell division. Cyclo(-D-Leu-D-Pro) has been shown to have antibacterial activity against the Gram negative bacterium Vibrio anguillarum. This drug has also been shown to have endophytic properties, as it was isolated from an endophytic fungus found in leaves of Eucalyptus trees. The stereoisomers of cyclo(-D-Leu-D-Pro) have different effects on bacterial cells, with one being more potent than the other.</p>Formula:C11H18N2O2Purezza:Min. 95%Colore e forma:PowderPeso molecolare:210.27 g/molBoc-Asp(OBzl)-OH
CAS:<p>Boc-Asp(OBzl)-OH is a cyclic peptide analog with an amino acid sequence homologous to the natural substrate of soybean trypsin. It has been shown to inhibit thrombin by intramolecular hydrogen bonding. Boc-Asp(OBzl)-OH has also been used as a prodrug for the synthesis of other analogs, such as Asp(OBzl)-Bz-NH2, which inhibits human immunodeficiency virus type 1 (HIV-1) protease. This inhibitor has been found to be effective in vitro and in vivo against HIV-1 strains that are resistant to other protease inhibitors, such as saquinavir, indinavir, and ritonavir.</p>Formula:C16H21NO6Purezza:Min. 95%Peso molecolare:323.34 g/molFmoc-Ser(tBu)-OH
CAS:<p>Fmoc-Ser(tBu)-OH is a synthetic peptide that is used in the synthesis of peptides and proteins. It is synthesized by using a stepwise procedure, which involves the use of morpholine as an organic base to deprotonate the carboxylic acid group and then reacting it with trifluoroacetic acid (TFA) to form the corresponding chloroformate ester. The amide bond is formed by reaction with ammonia or an amine. Finally, it can be reacted with hydrochloric acid to form the corresponding hydrochloride salt, which is insoluble in water. Impurities such as thionyl chloride and chloroformate can be removed by washing with methylene chloride or chloroform, respectively. Fmoc-Ser(tBu)-OH has been shown to be selective for the formation of hydrophobic bonds between amino acids and is not reactive toward other side chains on the protein.</p>Formula:C22H25NO5Purezza:Min. 98.0 Area-%Peso molecolare:383.45 g/molH-EIDTVLPNK^-OH
Peptide H-EIDTVLPNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Ser-Leu-Ile-Gly-Arg-Leu-NH2
CAS:<p>H-Ser-Leu-Ile-Gly-Arg-Leu-NH2 is a cyclase inhibitor that binds to the neurokinin 1 receptor, leading to an inhibition of the release of inflammatory substances in the bowel. HSLIGRL can also inhibit epidermal growth factor (EGF), which suppresses inflammation and cell proliferation. HSLIGRL also inhibits inflammatory bowel disease by decreasing the production of prostaglandins, which are chemical messengers involved in pain and inflammation. HSLIGRL has been shown to be effective against low potency benzalkonium chloride, which is often used as a preservative in pharmaceuticals. This compound has been shown to reduce inflammation by inhibiting proinflammatory cytokines such as TNFα and IL1β.</p>Formula:C29H56N10O7Purezza:Min. 95%Peso molecolare:656.83 g/molObestatin (Human)
CAS:Obestatin is a 23 amino acid gastrointestinal peptide, encoded for by the ghrelin gene and is known to reduce food intake through supressing appetite. This peptide has been found to influence the pancreas, cardiovascular system and adipose tissues as well as the gastrointestinal system. One study showed that when high-fat diet fed rats were given chronic administration of obestatin it prevented the development of non-alcoholic fatty liver disease. Consequently Obestatin has the potential to be used in preventing obesity-related diseases.Formula:C116H176N32O33Purezza:Min. 95%Peso molecolare:2,546.89 g/molH-SEVAHR^-OH
Peptide H-SEVAHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVVVGACGVGK^-OH
Peptide H-LVVVGACGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-23/aa89 - 103
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,824.1 g/molSIVmac239 - 8
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,845.2 g/molH-NVDLSTFYQNR^-OH
Peptide H-NVDLSTFYQNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVLTIDKK^-OH
<p>Peptide H-AVLTIDKK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
CAS:<p>H-His-D-Trp-Ala-Trp-D-Phe-Lys-NH2 is a potent activator of the human growth hormone receptor, which leads to increased levels of insulin growth factor 1 (IGF1). H-His-D-Trp-Ala-Trp-D-Phe-Lys NH2 causes an increase in locomotor activity and somatotrophs. This peptide has been shown to be effective in treating metabolic disorders such as obesity and diabetes mellitus type 2. It also has antiviral properties that may be useful for the treatment of infectious diseases, such as HIV.</p>Formula:C46H56N12O6Purezza:Min. 95%Peso molecolare:873.04 g/molAc-Asp-Glu-Val-Asp-H (aldehyde)
CAS:<p>Ac-Asp-Glu-Val-Asp-H (aldehyde) is a peptide that belongs to the group of ligands. It has been used as an inhibitor of ion channels and as an antibody for cell biology research. Ac-Asp-Glu-Val-Asp-H (aldehyde) is a potent activator of the class IB metabotropic glutamate receptors and has been shown to inhibit the activity of the Na+/K+ ATPase pump in rat brain synaptosomes. This peptide also binds to beta 2 adrenergic receptors with high affinity, but does not activate them.</p>Formula:C20H30N4O11Purezza:Min. 95%Peso molecolare:502.47 g/molGlt-Gly-Arg-MCA
CAS:Glt-Gly-Arg-MCA is a research tool that is used to activate the GLT1 receptor. It binds to the GLT1 receptor and activates it by binding to the Ligand-binding site. Glt-Gly-Arg-MCA has been shown to be an inhibitor of ion channels, such as Na+ channels, K+ channels, Ca2+ channels and voltage-gated Ca2+ channels. This product also binds to antibody molecules and inhibits their ability to bind with antigens or receptors. Glt-Gly-Arg-MCA has been used in research for Cell Biology, Pharmacology, and Life Science.Formula:C23H30N6O7Purezza:Min. 95%Peso molecolare:502.52 g/molBoc-Asp(OcHex)-OH
CAS:<p>Boc-Asp(OcHex)-OH is a peptide with pharmacological and biological properties. It is an inhibitor of the phospholipase A2 enzyme, which plays a role in inflammation. Boc-Asp(OcHex)-OH also has been shown to activate the epidermal growth factor receptor (EGFR). This peptide has been used as a research tool for studying protein interactions and is also used as an antibody.</p>Formula:C15H25NO6Purezza:Min. 95%Peso molecolare:315.36 g/molβ-Defensin-2 (Human) Antiserum
<p>β-defensin-2 Antiserum is a research tool that can be used to study the interactions of ion channels, receptor and ligand. It is likely to be used in pharmacology and protein interactions. β-defensin-2 Antiserum is purified and has an affinity for antibody proteins.</p>Purezza:Min. 95%VIP Antagonist
CAS:<p>VIP Antagonist is a drug that inhibits the α7 nicotinic acetylcholine receptor and has been shown to have inhibitory properties against cancer tissues. The drug blocks the response element for VIP, inhibiting cyclase activity. This prevents the production of VIP and other neuropeptides, which are involved in nerve cell growth and survival. VIP Antagonist also inhibits toll-like receptor signaling pathways by blocking TLR2 and TLR4, which are receptors on immune cells that recognize bacterial products. In addition, this drug binds to human immunoglobulin G (IgG) and prevents it from binding to its Fc receptor on immune cells, thus preventing IgG-mediated complement activation or antibody-dependent cellular cytotoxicity.</p>Formula:C154H257N49O40SPurezza:Min. 95%Peso molecolare:3,467.06 g/molMBP (63-81)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,645.1 g/molH-LSAPGSQR^-OH
Peptide H-LSAPGSQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Melittin
CAS:<p>Melittin is a major component of bee venom that has been shown to have antibacterial efficacy against gram-positive bacteria, including methicillin-resistant Staphylococcus aureus. It also demonstrates anti-viral activity, for example it inhibits human immunodeficiency virus and herpes simplex virus. Furthermore it can be used in the treatment of inflammatory-related illnesses due to it inhibiting the phospholipase A2 enzyme. In addition to this Melittin's abaility to inhibit inflammatory mediators such as nitric oxide and cyclooxygenase-2 aids in the treatment of inflammatory diseases. As a result of Melittin having the capabilities of attacking lipid membranes and it surpressing COX-2 mRNA expression it can also be used in the treatment of tumours. The bound form of melittin is not toxic to mammalian cells, but it is toxic when it is released into the cell cytoplasm. Melittin has been shown to inhibit transcriptional regulation and locomotor activity in mice. This may be due to its ability to bind DNA, preventing transcription and translation of certain genes. Lastly It has strong hemolytic activity and been seen to increase insulin secretion via depolarization of pancreatic beta-cells. Melittin is a diverse peptide which can be used ina whole spectrum of research and therapeutic areas.</p>Formula:C131H229N39O31Purezza:Min. 95%Peso molecolare:2,846.47 g/molFmoc-Lys(Biotin)-OH
CAS:<p>Fmoc-Lys(Biotin)-OH is a biotin-reactive derivative of the lysine amino acid. It is used to study the interactions between bacterial pathogens and human cells. Fmoc-Lys(Biotin)-OH has been shown to inhibit the growth of P. aeruginosa in thp-1 cells, which are immortalized human lung epithelial cells. This drug also inhibits the synthesis of proteins in the cell nuclei, which prevents the development of bacterial colonies on solubilized cell nuclei in human serum. The effects of Fmoc-Lys(Biotin)-OH have been observed using an unlabeled drug and preincubation with unlabeled protein to observe cytosolic protein synthesis inhibition. A confocal microscope was used to show that Fmoc-Lys(Biotin)-OH inhibited recombinant proteins that bind to human pathogens, such as Staphylococcus a</p>Formula:C31H38N4O6SPurezza:Min. 95%Peso molecolare:594.74 g/molBoc-D-Tyr(Br-Z)-OH
CAS:<p>Boc-D-Tyr(Br-Z)-OH is a sugar alcohol that has been shown to have anti-bacterial activity. It has been shown to inhibit the growth of dental plaque by inhibiting the synthesis of oligosaccharides, which are a major component of this type of biofilm. Boc-D-Tyr(Br-Z)-OH also inhibits transfer reactions in the bacterial cell wall, and is therefore able to prevent the formation of cell walls. This compound also has prebiotic properties, which may be due to its ability to stimulate insulin production. The enzyme responsible for Boc-D-Tyr(Br-Z)-OH synthesis is Tools for Peptide Synthesis (TPS). TPS catalyzes a chemical reaction that uses an acceptor molecule (e.g., ATP) and microbial metabolism as substrates. The product of this enzymatic reaction is fatty acids, which are then used in biosynthesis processes such as fatty acid</p>Formula:C22H24NO7BrPurezza:Min. 95%Peso molecolare:494.33 g/molLeupeptin hemisulfate anhydrous
CAS:<p>Leupeptin is a protease inhibitor that inhibits the activity of proteases in cells. It has been shown to inhibit transcriptional regulation and apoptosis pathway, as well as possessing anti-inflammatory properties. Leupeptin has been shown to have inhibitory properties against a variety of proteases, including group P2 metalloproteases, cathepsin D, and proteinase 3. This drug has also been shown to prevent neuronal death in experimental models by inhibiting cell lysis. Leupeptin binds to the active site of the enzyme by forming hydrogen bonds with conserved amino acid residues and steric interactions with nearby amino acid residues. The redox potentials of leupeptin are not known, but it is assumed that they are low enough for its antioxidant properties to be effective.</p>Formula:C20H38N6O4H2SOPurezza:Min. 90 Area-%Peso molecolare:475.6 g/molH-LITTQQWLIK^-OH
Peptide H-LITTQQWLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FQTLLALHR^-OH
Peptide H-FQTLLALHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.X-Neu5Ac
CAS:<p>X-Neu5Ac is a peptide inhibitor of the protein interactions. It has been shown to activate the Ligand, which may be due to its ability to bind to the Receptor. This drug has been used as a research tool for studying ion channels and antibodies. X-Neu5Ac is a high purity product that can be used in life science research.</p>Formula:C19H22N2O9BrClPurezza:Min. 95%Peso molecolare:537.74 g/molBoc-Ile-OH • 1/2 H2O
CAS:<p>Boc-Ile-OH • 1/2 H2O is a synthetic monomer that can be used in peptide synthesis. It is detectable under microscopy and chromatography, and is a component of the Tool for Peptide Synthesis. Boc-Ile-OH • 1/2 H2O has a nature that is synthetic and industrialized, an amino acid composition that is synthetic, and can be used as a monomer in polymerization reactions. This compound also shows enhancement of acidic radical chain reactions. The chromatographic method used to identify this compound utilizes TLC on alumina plates, which are then sprayed with ninhydrin reagent or phosphomolybdic acid reagent. The plate is heated until the solvent evaporates and the residue remains on the plate.</p>Formula:C11H21NO4H2OPurezza:Min. 95%Peso molecolare:240.3 g/molH-GDLIAEVETDK^ATV-OH
Peptide H-GDLIAEVETDK^ATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Rhod-VPMLKE-OH
<p>Peptide Rhod-VPMLKE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-mini-PEG-2-ClTrt-Resin (100-200 mesh) 1% DVB
<p>crosslinkage: 1% DVBResin: 100 - 200 meshsubstitution: ca 0.7 meq/g</p>Purezza:Min. 95%H-GQVLVFLGQSEGLR^-OH
Peptide H-GQVLVFLGQSEGLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-64
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,795.2 g/molCharybdotoxin
CAS:<p>Charybdotoxin is a potent and selective ion channel inhibitor. It is a peptide that binds to the receptor site of the potassium channels that are found in nerve cells, blocking their activation. Charybdotoxin has also been shown to inhibit the activity of ligand-gated ion channels, such as acetylcholine receptors. This toxin has been used in research as a tool for studying protein interactions and has also been used in pharmacology as an experimental drug for treating hypertension.</p>Formula:C176H277N57O55S7Purezza:Min. 95%Peso molecolare:4,295.9 g/molH-TITLEVESSDTIDNVK^-OH
Peptide H-TITLEVESSDTIDNVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLELTSDNDR^-OH
Peptide H-VLELTSDNDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VL^IGLDLLYGELQDSDDF-OH
Peptide H-VL^IGLDLLYGELQDSDDF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FLRGRAYGL^-OH
Peptide H-FLRGRAYGL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DIVGAVLK^-OH
Peptide H-DIVGAVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.β-Sheet Breaker Peptide iAß5 (Bulk)
CAS:β-Sheet Breaker Peptide iAß5 (Bulk) is a peptide that inhibits the formation of β-sheets in proteins. It has been shown to be an excellent inhibitor of protein interactions, with good selectivity for its target. This peptide also has high purity and can be used as a research tool for studying the function of ion channels and antibodies.Formula:C33H43N5O8Purezza:Min. 95%Peso molecolare:637.74 g/molBiotin-dPEG®11-MAL
CAS:<p>Biotin-dPEG®11-MAL is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Biotin-dPEG®11-MAL is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formula:C41H71N5O16SPurezza:Min. 95%Peso molecolare:922.09 g/molAc-Arg-Leu-Arg-MCA
CAS:<p>Ac-Arg-Leu-Arg-MCA is a fluorogenic substrate for the proteasome that can be used in proteasome research. Ac-Arg-Leu-Arg-MCA has been shown to be a useful fluorescent substrate for the ubiquitin proteasome system substrates and peptides and biochemicals. It is also an Enzyme Substrate of the Peptides & Biochemicals section.</p>Formula:C30H46N10O6Purezza:Min. 95%Peso molecolare:642.76 g/molDiprotin B
CAS:<p>Diprotin B is a colony-stimulating factor protein that has inhibitory properties in the colon. It has been shown to be effective in reducing symptoms of bowel disease and inflammatory bowel disease, as well as reducing the recurrence of colon cancer. Diprotin B inhibits the release of inflammatory cytokines such as tumor necrosis factor-α (TNF-α) and interleukin-6 (IL-6). The inhibition of these proinflammatory cytokines may contribute to the anti-inflammatory effects observed with Diprotin B treatment. Diprotin B also prevents cytosolic calcium accumulation, which can lead to cell lysis. This process is mediated by antimicrobial peptides called defensins that are expressed in Paneth cells found in the small intestine and colon. Defensins have also been shown to induce cell lysis through their ability to bind to bacterial membranes.</p>Formula:C16H29N3O4Purezza:Min. 95%Peso molecolare:327.43 g/molH-VDATEESDLAQQYGVR^-OH
<p>Peptide H-VDATEESDLAQQYGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NNLEAL^EDFEK-OH
<p>Peptide H-NNLEAL^EDFEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LIFAGKQLEDGR-NH2
<p>Peptide H-LIFAGKQLEDGR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Pepstatin A (Synthetic)
CAS:<p>Pepstatin A is a natural product that has been synthesized for use as an inhibitor of proteolytic enzymes. It inhibits the activity of a wide range of proteases and is used in vitro to study the biochemical properties of these enzymes. Pepstatin A inhibits the activity of many important proteases, including those involved in infectious diseases, such as HIV and hepatitis C virus. Pepstatin A binds to the active site on serine proteases, blocking access by their substrates and thereby inhibiting enzyme activity. The binding site is highly conserved among different types of serine protease, with approximately 90% homology between trypsin and chymotrypsin. The inhibitory mechanism involves a specific interaction between pepstatin A's hydrophobic side chain and the catalytic triad residues His57, Asp102, and Ser195 in trypsin or His57, Asp102, and Ser188 in chymotrypsin.</p>Formula:C34H63N5O9Purezza:Min. 95%Peso molecolare:685.89 g/molS-Acm-ß-Mercaptopropionic Acid
CAS:<p>S-Acm-ß-Mercaptopropionic Acid is a selective activator of the human K+ channel KCNQ2/KCNQ3. It is a potent inhibitor of the hERG potassium channel. S-Acm-ß-Mercaptopropionic Acid is a ligand that binds to and activates KCNQ2 and KCNQ3 channels in heart muscle cells. It has shown to be an antibody for the study of ion channels, as well as other receptors and cell biology. This molecule has been used as a research tool for studying protein interactions and pharmacology.</p>Formula:C6H11NO3SPurezza:Min. 95%Peso molecolare:177.22 g/molCilengitide
CAS:<p>Cilengitide is a new chemotherapeutic agent that was shown to be effective against renal cell cancer in vitro. Cilengitide inhibits the polymerase chain reaction, arresting the growth of cells. It has minimal toxicity and natural compounds, which make it a promising drug for the treatment of human cancers. Cilengitide binds to integrin receptors on malignant brain cells and inhibits their ability to migrate, inducing apoptosis. This drug also inhibits the production of chemoattractant protein and can be used as an adjuvant therapy for radiation and antibiotic-resistant strains of bacteria.</p>Formula:C27H40N8O7Purezza:Min. 95%Peso molecolare:588.67 g/mol1-(Fmoc-Aminomethyl)-β-D-Galacturonic Acid
CAS:1-(Fmoc-Aminomethyl)-Beta-D-Galacturonic Acid is a glycopeptide that has been shown to be taken up by the cells of humans. It is also effective when given at doses of 1 mg/kg. This drug can be pegylated, which increases its uptake in humans and prevents it from being degraded in the liver. The pharmacokinetic properties of 1-(Fmoc-Aminomethyl)-Beta-D-Galacturonic Acid have been studied in humans, where it was found that this drug can be detected in plasma as well as in urine after single or multiple doses. The human studies done with this drug have shown that it has a short half life and is quickly eliminated from the body. Positron emission tomography (PET) studies have indicated that this drug may bind to specific receptors on the surface of cells, which could potentially lead to new diagnostic applications for beta-galactosidFormula:C22H23NO8Purezza:Min. 95 Area-%Peso molecolare:429.42 g/molBoc-Cys(tBu)-OH
CAS:<p>Boc-Cys(tBu)-OH is a peptide that is an activator of ion channels. It is used as a research tool to study protein interactions, antibody binding, and cell biology. The peptide has been shown to act as an inhibitor of ion channels by binding to the extracellular domain of the receptor and inhibiting ligand binding. It has also been shown to activate potassium channels in mammalian cells.</p>Formula:C12H23NO4SPurezza:Min. 95%Peso molecolare:277.38 g/molH-CMLVELHTQSQDRF-NH2
<p>Peptide H-CMLVELHTQSQDRF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Boc-D-Pro-OH
CAS:<p>Boc-D-Pro-OH is a model compound for the synthesis of peptides. Boc-D-Pro-OH has been used in many surface-enhanced Raman spectroscopy studies to investigate the stereochemistry of glycosidic bonds. It has also been used in pharmacokinetic studies to investigate the drug's absorption, distribution, metabolism, and excretion (ADME) properties. The solute is soluble in water due to its hydrophilic nature. Boc-D-Pro-OH is an enantiomer of Boc-L-Pro-OH and a functional group that contains a trifluoromethyl group. This chemical can be used in Tools for Peptide Synthesis with other compounds to form peptides with specific amino acid sequences.</p>Formula:C10H17NO4Purezza:Min. 95%Peso molecolare:215.25 g/molH-TVAAPSVFIFPPSDEQL^K-OH
Peptide H-TVAAPSVFIFPPSDEQL^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.[Trp3, Arg5]-Ghrelin (1-5)
CAS:<p>[Trp3, Arg5]-Ghrelin (1-5) is a Growth-Hormone Secretagogue (GHS) receptor agonist which stimulates growth hormone release . The full lenth 28 amino acid peptide Ghrelin is a peptide hormone that regulates appetite, energy balance, meal initiation and nutrient sensing. Ghrelin is produced in the stomach, but is also found in the blood, brain, and other tissues.. It influences bodily functions through associating with growth hormone secretagogue receptors (GHS-R) through its unique N-octanoyl group which is linked to its serine 3 residue covalently. It wider functions are in the regulation of insulin resistance, diabetes and obesity. On top of this Ghrelin is also found to be involved with glucose homeostasis, energy homeostasis, cardio-protective effects, bone metabolism and is a potential target for cancer. Therefore it can be used to develop therapies for a whole spectrum of diseases. This molecule is used as a research tool for studying cell biology and pharmacology.</p>Formula:C31H41N9O7Purezza:Min. 95%Peso molecolare:651.73 g/molLL-37 ( Human)
CAS:<p>LL-37 is a 37 amino acid peptide that is produced by neutrophils and other leukocytes. This peptide has been shown to have anti-inflammatory properties, which may be due to its ability to bind and activate the G protein coupled receptor (GPCR) formyl peptide receptor-like 1 (FPRL1), leading to inhibition of the production of inflammatory mediators such as IL-8. LL-37 also binds to ion channels, which may lead to membrane depolarization, thereby blocking calcium influx into the cell. LL-37 has been shown to inhibit the activation of T cells by inhibiting T cell receptor signaling and reducing cytokine production.<br>LL-37 also has a high affinity for antibody binding sites on B cells and macrophages and can bind with high specificity to IgE on mast cells, leading to inhibition of mast cell degranulation. The binding of LL-37 with these receptors leads to reduced inflammation in tissues, which may</p>Formula:C205H340N60O53Purezza:Min. 95%Peso molecolare:4,493.3 g/molLMP2 (340-350), SSC
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,111.3 g/mol5Azido-AAAYSSGAPPMPPF-OH
<p>Peptide 5Azido-AAAYSSGAPPMPPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fmoc-Cys(Trt)-OH
CAS:<p>Fmoc-Cys(Trt)-OH is a chemical compound that has been shown to have potent antitumor activity in mice. It is synthesized by the stepwise addition of amino acids to the resin-bound Cys residue in the presence of trifluoroacetic acid and a coupling agent such as EDC. This reaction produces a functional protein with an amide bond. The acetylcholine receptor binding properties of Fmoc-Cys(Trt)-OH are due to its ability to form a disulfide bond with cysteine residues on the receptor.</p>Formula:C37H31NO4SPurezza:Min. 98.0 Area-%Peso molecolare:585.71 g/molH-GSGFFVFSR^-OH
<p>Peptide H-GSGFFVFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ISVYYNEATGGK^^-OH
Peptide H-ISVYYNEATGGK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-ASQETFG-NHMe
<p>Peptide Ac-ASQETFG-NHMe is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QMVQQFK^-OH
<p>Peptide H-QMVQQFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 98
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,657.9 g/molBivalirudin
CAS:<p>Bivalirudin is a synthetic cyclic peptide that binds to the ATP-binding cassette transporter and inhibits the activity of the proteolytic enzyme, angiotensin-converting enzyme (ACE). ACE inhibition prevents the conversion of angiotensin I to angiotensin II. Bivalirudin has been shown to be effective in reducing mortality in patients with acute coronary syndrome or undergoing percutaneous coronary intervention. It has also been shown to have pharmacokinetic properties that are similar to those of heparin. The drug has a low dose and is not associated with an increased risk of bleeding. Bivalirudin is an inhibitor and can cause drug interactions when combined with other drugs that are inhibitors or substrates for this type of transporter.</p>Formula:C98H138N24O33Purezza:Min. 95%Peso molecolare:2,180.33 g/molNeuropeptide S (Human)
CAS:Neuropeptide S is a neuropeptide and a novel modulator of arousal and anxiety. This neuropeptide is found in the mammalian brain and is also involved in the suppression of food intake, reward-like effects, mediation of fear expression and memory and learning processes. This product can be used in pharmacological research and is available as a 0.5 mg vial.Formula:C93H155N31O28SPurezza:Min. 95%Peso molecolare:2,187.5 g/molSIVmac239-1
<p>Peptide SIVmac239-1 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C65H115N21O23S1Peso molecolare:1,590.83 g/molVal-Ile-Ile
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C17H33N3O4Peso molecolare:343.46 g/molvitamin D binding protein precrusor (208-218) [Homo sapiens]/[Oryctolagus cuniculus]
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C54H95N17O17Peso molecolare:1,254.44 g/molH-GLPSSI^EK^-OH
Peptide H-GLPSSI^EK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-GCRDGPQGIWGQDRCG-OH
Peptide Ac-GCRDGPQGIWGQDRCG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Enterotoxin STp
CAS:<p>Enterotoxin STp is an Escherichia coli Enterotoxin, with the following disulfide bonds: Cys5 and Cys10; Cys6 and Cys14; Cys9 and Cys17 and available as the trifluoroacetate salt.<br>One-Letter-Code: H-NTFYCCELCCNPACAGCY-OH</p>Formula:C81H110N20O26S6Purezza:Min. 95%Peso molecolare:1,972.26 g/molH-LCTP^SR-OH
Peptide H-LCTP^SR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.IL 4 Human
<p>IL 4 is a cytokine that is responsible for the proliferation and activation of B cells, T cells, macrophages and other immune cells. IL 4 binds to the high affinity receptor IL-4Rα. It also activates the membrane bound IL-4Rβ. The IL-4Rα is a heterodimer consisting of an alpha chain, which is shared by all members of the type II cytokine receptor family, and the common beta chain shared by all type I cytokines receptors. IL-4 has been shown to be effective in inhibiting tumor growth in vivo and in vitro.</p>Purezza:>98% By Sds-Page And Rp-Hplc.Dabcyl-Leu-Ala-Gln-Ala-Val-Arg-Ser-Ser-Ser-Arg-Edans
CAS:<p>TNF-a is shed from cell membranes by TNF-a-FW cleaving enzyme (TACE). Incubation of the TACE substrate with recombinant human TACE gives a specific cleavage to restore the quenched fluorescence. The substrate is widely used to screen inhibitors of TNF-α converting enzyme (TACE, ADAM17 endopeptidase) activity. On application is its use as a TACE FRET Substrate I and it is available as a Trifluoroacetate Salt.</p>Formula:C70H104N22O18SPurezza:Min. 95%Peso molecolare:1,573.81 g/molFmoc-D-Lys(Boc)-OH
CAS:<p>Fmoc-D-Lys(Boc)-OH is a building block for the synthesis of peptides. It can be used to synthesize chains that are up to 17 amino acids long. Fmoc-D-Lys(Boc)-OH is a protected amino acid with an active group on the alpha carbon and has been used in the synthesis of ganirelix acetate, a peptide that is used in the treatment of prostate cancer. The Boc group is an organic compound that protects the lysine side chain from reacting with other compounds. The Fmoc group is also an organic compound, which helps to protect the side chain from reactions with other compounds. These groups are removed at different stages of synthesis, depending on what type of reaction needs to take place next.</p>Formula:C26H32N2O6Purezza:Min. 95%Peso molecolare:468.55 g/molMOCAc-Lys-Pro-Leu-Gly-Leu-Dap(Dnp)-Ala-Arg-NH2
CAS:MOCAc-Lys-Pro-Leu-Gly-Leu-Dap(Dnp)-Ala-Arg-NH2 is a peptide that has been shown to inhibit the activity of ADAM17. It blocks the cleavage of proMMP1, MMP2, and MMP9 and inhibits collagenase, stromelysin, and cathepsin activities. This peptide may be useful for the prevention and treatment of diseases associated with excessive proteolytic activity such as arthritis or cancer.Formula:C55H80N16O16Purezza:Min. 95%Peso molecolare:1,221.35 g/molH-Glu-Lys-OH
CAS:H-Glu-Lys-OH is an amino acid that has been used for structural analysis and as a pharmacological tool. This compound has been shown to be an agonist at the apical membrane of intestinal cells, where it stimulates the release of growth factors. H-Glu-Lys-OH has also been shown to have potent antagonist activity against the glutamate receptor in caco-2 cells. The reaction products of this amino acid are stabilizing for dna polymerase chain reactions.Formula:C11H21N3O5Purezza:Min. 95 Area-%Colore e forma:PowderPeso molecolare:275.3 g/molAc-CDVFSVKTEMIDQEEGIS-OH
Peptide Ac-CDVFSVKTEMIDQEEGIS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IQAEPDNLAR^-OH
Peptide H-IQAEPDNLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVTSANIQEFAGCK^-OH
<p>Peptide H-AVTSANIQEFAGCK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TIVGALIQSVK^-OH
Peptide H-TIVGALIQSVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-STAGNFLVNPLEPK^-OH
Peptide H-STAGNFLVNPLEPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Pro-Asp-Pro
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C14H21N3O6Peso molecolare:327.33 g/molAminomethylated Polystyrene Resin • HCl (200-400 mesh) 1% DVB
Aminomethylated Polystyrene Resin • HCl (200-400 mesh) 1% DVB is a purified solid resin that has been chemically modified with amine groups. This product can be used as an inhibitor, activator, or ligand in research applications. Aminomethylated Polystyrene Resin • HCl (200-400 mesh) 1% DVB is also useful as a reagent for Protein interactions and Receptor binding studies. It is available in high purity and can be used as a research tool in Cell Biology and Pharmacology experiments.Purezza:Min. 95%H-EQLSSVSSF^ER-OH
Peptide H-EQLSSVSSF^ER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-V^VGGLVALR^-OH
Peptide H-V^VGGLVALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
