Informazioni sul prodotto
- H-His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Al a-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH
- [Gly2]-GLP-2 (human) HGDGSFSDEMNTILDNLAARDFINWLIQTKITD
- Alx 0600
Teduglutide is a Glucagon-like Peptide-2 Analog which has been used in the treatment of Short Bowel Syndrome. It is avaiable in the Trifluoroacetate salt form.
One-Letter Formula: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD
Proprietà chimiche
Richiesta tecnica su: 3D-TED-3880-PI Teduglutide
Se si desidera richiedere un preventivo o effettuare un ordine, si prega invece di aggiungere i prodotti desiderati al carrello e poi richiedere un preventivo o un ordine dal carrello. È più veloce, più economico, e potrà beneficiare degli sconti disponibili e di altri vantaggi.