PIGF1 protein
Ref. 3D-30R-AP036_B
Undefined size | To inquire |
Product Information
LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSE VEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYV ELTFSQHVRCECRPLREKMKPERCGDAVPRR
Chemical properties
Technical inquiry about: 3D-30R-AP036_B PIGF1 protein
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.