Amyloid beta/A4 Protein Precursor770 (740-770) trifluoroacetate salt
CAS: 1802086-24-3
Ref. 3D-FA109756
1mg | 443.00 € | ||
2mg | 669.00 € | ||
5mg | 1,179.00 € | ||
10mg | 2,035.00 € | ||
500µg | 265.00 € |
Product Information
- H-Ala-Ala-Val-Thr-Pro-Glu-Glu-Arg-His-Leu-Ser-Lys-Met-Gln-Gln-Asn-Gly-Tyr-Glu-Asn-Pro-Thr-Tyr-Lys-Phe-Phe-Glu-Gln-Met-Gln-Asn-OH H- AAVTPEERHLSKMQQNGYENPTYKFFEQMQN-OH
Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (740-770) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Chemical properties
Technical inquiry about: 3D-FA109756 Amyloid beta/A4 Protein Precursor770 (740-770) trifluoroacetate salt
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.