Amyloid beta-Protein (1-39) trifluoroacetate salt
CAS: 115427-62-8
Ref. 3D-FA110113
1mg | 741.00 € | ||
2mg | 1,136.00 € | ||
5mg | 2,464.00 € | ||
250µg | 297.00 € | ||
500µg | 483.00 € |
Product Information
- H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe- Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-G ly-Leu-Met-Val-Gly-Gly-Val-OH H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV-OH
Please enquire for more information about Amyloid beta-Protein (1-39) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Chemical properties
Technical inquiry about: 3D-FA110113 Amyloid beta-Protein (1-39) trifluoroacetate salt
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.