Big Endothelin-3 (1-41) amide (human) trifluoroacetate salt
CAS: 133551-97-0
Ref. 3D-FB110162
10mg | 1,770.00 € | ||
25mg | 2,360.00 € | ||
50mg | 2,950.00 € | ||
100mg | 4,130.00 € | ||
250mg | 5,899.00 € |
Product Information
- H-CTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFR-NH2
Big endothelin-3 is a peptide that is a potent inhibitor of the endothelin receptor. It has been shown to inhibit the binding of endothelin to its receptors and antagonize the effects of endothelin on cells. Big endothelin-3 is a research tool for studying protein interactions, activators, and ligands. This product is the ammonium acetate salt form.
Chemical properties
Technical inquiry about: 3D-FB110162 Big Endothelin-3 (1-41) amide (human) trifluoroacetate salt
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.