Peptide YY (human) trifluoroacetate salt
CAS: 118997-30-1
Ref. 3D-FP110394
1mg | 820.00 € | ||
2mg | 1,328.00 € | ||
5mg | 2,892.00 € | ||
250µg | 340.00 € | ||
500µg | 490.00 € |
Product Information
- H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Ar g-Gln-Arg-Tyr-NH2 H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
- H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
Peptide YY (PYY) is a 36-amino acid peptide that is secreted by the gut. PYY is a potent inhibitor of food intake and glucose homeostasis in rats and may be involved in the regulation of lipid metabolism. The trifluoroacetate salt form of PYY has been shown to have improved solubility, stability, and bioavailability. It has also been found to be more selective for the PYY receptor than other forms of PYY. The trifluoroacetate salt form of PYY remains stable to phase chromatography under acidic conditions but degrades at higher pH levels.
Chemical properties
Technical inquiry about: 3D-FP110394 Peptide YY (human) trifluoroacetate salt
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.