Product Information
- Gly-Phe-Gly-Cys-Asn-Gly-Pro-Trp-Asp-Glu-Asp-Asp-Met-Gln-Cys-His-Asn-His-Cys-Lys-Ser-Ile-Lys-Gly-Tyr-Lys-Gly-Gly-Tyr-Cys-Ala-Lys-Gly- Gly-Phe-Val-Cys-Lys-Cys-Tyr
A synthetic antimicrobial peptide whose sequence is derived from the Fungus, Pseudoplectania nigrella. This product has disulfide bonds between Cys4-Cys30, Cys15-Cys37, and Cys19-Cys39 and is available as a hydrochloride salt and as a 0.1mg vial.
One letter code: GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY
Chemical properties
Technical inquiry about: 3D-PDF-4432-S Plectasin
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.