H-FTLIELLIVVAIIGILAAIAIPQFSAYRVKAYNSAASSDLRNLKTALESAFADDQTYPPES-OH
Ref. 3D-PP49310
| 1mg | 861.00 € | ||
| 10mg | 1,005.00 € | ||
| 100mg | 2,253.00 € |
Product Information
Peptide H-FTLIELLIVVAIIGILAAIAIPQFSAYRVKAYNSAASSDLRNLKTALESAFADDQTYPPES-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-FTLIELLIVVAIIGILAAIAIPQFSAYRVKAYNSAASSDLRNLKTALESAFADDQTYPPES-OH include the following: Semi-supervised machine learning workflow for analysis of nanowire morphologies from transmission electron microscopy images S Lu , B Montz, T Emrick, A Jayaraman - Digital Discovery, 2022 - pubs.rsc.orghttps://pubs.rsc.org/en/content/articlehtml/2022/dd/d2dd00066k
Chemical properties
Technical inquiry about: 3D-PP49310 H-FTLIELLIVVAIIGILAAIAIPQFSAYRVKAYNSAASSDLRNLKTALESAFADDQTYPPES-OH
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.
