H-PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC-OH
Ref. 3D-PP49553
| 1mg | 601.00 € | ||
| 10mg | 740.00 € | ||
| 100mg | 1,462.00 € |
Product Information
Peptide H-PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC-OH include the following: TransCon CNP, a sustained-release C-type natriuretic peptide prodrug, a potentially safe and efficacious new therapeutic modality for the treatment of comorbidities VM Breinholt, CE Rasmussen, PH Mygind - of Pharmacology and , 2019 - ASPEThttps://jpet.aspetjournals.org/content/370/3/459.abstract
Chemical properties
Technical inquiry about: 3D-PP49553 H-PGQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC-OH
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.
