H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2
Ref. 3D-PP49768
| Undefined size | To inquire |
Product Information
Peptide H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2 include the following: Lipid nanoparticles produce chimeric antigen receptor T cells with interleukin-6 knockdown in vivo J Zhou, L Sun , Y Jia, Z Wang, T Luo, J Tan - Journal of Controlled , 2022 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S0168365922005387
Chemical properties
Technical inquiry about: 3D-PP49768 H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.
