
Product Information
- H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Va l-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gl y-Leu-Met-Val-Gly-Gly-Val-OH H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV-OH
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Chemical properties
Technical inquiry about: 3D-PP50218 Beta-Amyloid (1-39)
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.