GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat)
CAS: 87805-34-3
Ref. 3D-PP50515
Undefined size | To inquire |
Product Information
- GLP-1 (1-37) (human
- bovine
- guinea pig
- mouse
- rat) H-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-
- Glucagon-like peptide I (1-37)
- Glp-I (1-37)
- Glucagon-related peptide I (ox)
- Glycine, L-histidyl-L-alpha-aspartyl-L-alpha-glutamyl-L-phenylalanyl-L-alpha-glutamyl-L-arginyl-L-histidyl-L-alanyl-L-alpha-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-alpha-glutamylglycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-alpha-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-Llysylglycyl-L-arginyl-
- Glp-1
- See more synonyms
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Chemical properties
Technical inquiry about: 3D-PP50515 GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat)
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.