Product Information
- H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPP
H2N-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-amide is a catalog research peptide that is held in stock. This peptide is provided at >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer the product in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H2N-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-amide at the technical inquiry form on this page"
Chemical properties
Technical inquiry about: 3D-VAA-19699 Exendin 4
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.