Receptor Glucagon
Os receptores de glucagon são GPCRs que mediam os efeitos do glucagon, um hormônio envolvido na regulação da homeostase da glicose, promovendo a quebra de glicogênio e a liberação de glicose pelo fígado. Esses receptores são críticos na gestão dos níveis de açúcar no sangue e são de particular interesse no estudo do diabetes e distúrbios metabólicos. Antagonistas dos receptores de glucagon estão sendo explorados como potenciais tratamentos para hiperglicemia no diabetes tipo 2. Na CymitQuimica, oferecemos uma variedade de moduladores de receptores de glucagon de alta qualidade para apoiar sua pesquisa em endocrinologia, diabetes e regulação metabólica.
Foram encontrados 164 produtos de "Receptor Glucagon"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
GLP-1R agonist 29
<p>GLP-1R agonist 29 (Compound 20) is a GLP-1R agonist that induces hGLP-1R-mediated cAMP stimulation with an EC50 of 0.018 nM. It exhibits favorable pharmacokinetic properties and shows good in vivo exposure, with an AUC0-∞,sc of 77688 ng·h/mL.</p>Cor e Forma:Odour SolidExendin-3/4 (59-86)
<p>Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.</p>Fórmula:NAPureza:98%Cor e Forma:SolidPeso molecular:3055.49HAEGT
CAS:<p>HAEGT is the first N-terminal 1-5 residues of GLP-1 peptide.</p>Fórmula:C20H31N7O9Pureza:98%Cor e Forma:SolidPeso molecular:513.5Bay 55-9837
CAS:<p>Selective VPAC2 agonist; EC50: 0.4 nM (VPAC2), 100 nM (VPAC1), >1000 nM (PAC1). Enhances insulin secretion, reduces HIV-1 replication.</p>Fórmula:C167H270N52O46Pureza:98%Cor e Forma:SolidPeso molecular:3742.29FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
<p>FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.</p>Cor e Forma:SolidPeso molecular:3692.15Secretin (28-54), human TFA
<p>Secretin (28-54), human TFA is a 27-amino acid peptide that works on the human Secretin receptor.</p>Fórmula:C132H221N44F3O42Pureza:98%Cor e Forma:SolidPeso molecular:3153.48VU0453379
CAS:<p>VU0453379 is a highly selective and central nervous system penetrant positive allosteric modulator of glucagon-like peptide-1R (EC50: 1.3 μM).</p>Fórmula:C26H34N4O2Pureza:98%Cor e Forma:SolidPeso molecular:434.57VU0453379 hydrochloride
<p>VU0453379 hydrochloride: selective CNS-penetrant GLP-1R PAM, EC50 1.3 μM.</p>Fórmula:C26H35ClN4O2Cor e Forma:SolidPeso molecular:471.03GLP-1 receptor agonist 4
CAS:<p>GLP-1 receptor agonist 4 targets GLP-1R, EC50 64.5 nM, potential diabetes treatment research.</p>Fórmula:C51H44Cl2N4O6Pureza:98%Cor e Forma:SolidPeso molecular:879.82Glucagon-like peptide 1 (1-37), human TFA
<p>Human Glucagon-like peptide 1 (1-37) TFA is a potent GLP-1 receptor agonist derived from proglucagon.</p>Fórmula:C188H276N51F3O61Pureza:98%Cor e Forma:SolidPeso molecular:4283.5Albiglutide fragment TFA
<p>Albiglutide fragment (GLP-1 (7-36) analog) TFA represents a biologically active segment of Albiglutide, resistant to DPP-4 degradation due to its structure as a</p>Fórmula:C148H224N40O45·xC2HF3O2Cor e Forma:SolidGlucagon (19-29), human
CAS:<p>Glucagon, a 29-amino-acid hormone, is produced by alpha cells in the pancreas' islets of Langerhans.</p>Fórmula:C61H89N15O18SPureza:98%Cor e Forma:SolidPeso molecular:1352.53(R)-V-0219 hydrochloride
<p>(R)-V-0219 hydrochloride: Oral GLP-1R PAM, enantiomer of V-0219, triggers Ca2+ flux in hGLP-1R HEK cells.</p>Fórmula:C20H26ClF3N4O2Cor e Forma:SolidPeso molecular:446.89GLP-1 (9-36) amide
CAS:<p>GLP-1 (9-36) amide is an antagonist at the human GLP-1 receptor.</p>Fórmula:C140H214N36O43Pureza:97%Cor e Forma:SolidPeso molecular:3089.41Maridebart
CAS:<p>Maridebart is a humanized IgG1-kappa monoclonal antibody that targets the GIPR (gastric inhibitory polypeptide receptor) [1].</p>Cor e Forma:LiquidOxyntomodulin
CAS:<p>GLP-1 analog modulates appetite, boosts metabolism, and curbs gastric acid. Increases cAMP, mildly stimulates glucagon receptor.</p>Fórmula:C192H295N59O60SPureza:98%Cor e Forma:SolidPeso molecular:4421.86GLP-1 receptor agonist 8
CAS:<p>GLP-1 receptor agonist 8, potent for diabetes and obesity research, may also study NAFLD.</p>Fórmula:C34H36ClFN6O4Cor e Forma:SolidPeso molecular:647.14[Des-His1,Glu9]-Glucagon amide
CAS:<p>Glucagon blocker with pA2 of 7.2; no agonist effect. Boosts insulin; prevents glucagon-driven hyperglycemia in rabbits and diabetic rats.</p>Fórmula:C148H221N41O47SPureza:98%Cor e Forma:SolidPeso molecular:3358.68GLP-1(7-37)
CAS:<p>GLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells.</p>Fórmula:C151H228N40O47Pureza:98%Cor e Forma:SolidPeso molecular:3355.67GLP-1R agonist 15
CAS:<p>GLP-1R agonist 15 (Compound 101) is a GLP-1 receptor agonist [1] .</p>Fórmula:C46H47FN8O7SCor e Forma:SolidPeso molecular:874.98
![[Des-His1,Glu9]-Glucagon amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2033.webp&w=3840&q=75)
