Haletos orgânicos

<p>Please enquire for more information about Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Bromobenzaldehyde is an organic compound with the formula CHBrCHO. It is a colorless liquid that is soluble in many organic solvents. 3-Bromobenzaldehyde can be synthesized by the reaction of ethyl acetoacetate and anhydrous sodium in methanol, and can be purified by distillation or recrystallization from ethanol. This compound has been used as a solvent for analytical methods, such as GC-MS analysis, due to its high boiling point and low volatility. 3-Bromobenzaldehyde also reacts with hydrogen chloride to form benzoyl chloride, which can then be reacted with alcohols to produce esters. 3-Bromobenzaldehyde has been shown to react with chalcones to form optical active compounds, such as curcumin analogues. These reactions are typically carried out in solution using acetic acid or sulfuric acid as a catalyst.br&gt;br&gt;</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about (D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2,7-Bis[2-(diethylamino)ethoxy]-9-fluorenone dihydrochloride (2,7-BDFE) is a potent inducer of interferon. It is a natural compound that has been shown to have significant cytotoxicity against murine sarcoma virus and opportunistic fungal infections. 2,7-BDFE has also been shown to induce toll-like receptor 4 (TLR4), which triggers the production of other cytokines and chemokines. 2,7-BDFE has also been found to inhibit the growth of cancer cells in vitro and in vivo. This drug is used as an inhibitor for benzalkonium chloride for the prevention of bacterial contamination on surfaces.</p>

<p>7-Chloro-4-piperazinylquinoline is a quinoline derivative that belongs to the group of organic solvents. It has anticancer activity and is used as a medicine. 7-Chloro-4-piperazinylquinoline is used as an intermediate in the preparation of sorafenib, which is a potent inhibitor of the protein tyrosine kinase. Sorafenib inhibits cancer cell proliferation and tumor growth by blocking the activity of tyrosine kinases, which are necessary for cellular proliferation and survival. It also inhibits phospholipase A2, which leads to cell death by apoptosis.</p>

<p>5'-Bromo-2'-hydroxypropiophenone is a synthetic compound that inhibits the dimerization of survivin, which is a protein involved in cancer pathways. This compound has been shown to inhibit the growth of cells in culture and can be used as an inhibitor for assays. 5'-Bromo-2'-hydroxypropiophenone has also been shown to integrate into DNA, which may lead to chromosomal rearrangements and mutations. It also binds with high affinity to the family of modifications borealin, which are implicated in cellular processes such as cell differentiation and proliferation.</p>

<p>2-Amino-3,5-dibromobenzonitrile is an electrophile that is used to synthesize various boronic acid derivatives. It also inhibits butyrylcholinesterase and 2-aminobenzonitrile, enhancing the activity of organophosphorus cholinesterase inhibitors. 2-Amino-3,5-dibromobenzonitrile has been shown to react with nucleophiles at the alpha position to form a stable intermediate. This reaction has been shown to be reversible in aqueous solution. The compound has been evaluated as a potential chemotherapeutic agent against cancer cells in vitro.</p>

<p>4-Chloro-Niacin is a lead compound for the treatment of diabetes. The drug is an agonist of the G protein coupled receptor, which is involved in glucose homeostasis and insulin secretion. 4-Chloro-Niacin has been shown to decrease blood glucose levels in diabetic rats by activating the G protein coupled receptor, thereby increasing the release of insulin from pancreatic beta cells. This compound also has an affinity for pyridine nucleotide receptors, suggesting that it may be useful for treating metabolic syndromes.</p>

<p>Nalpha-(5-fluoro-2,4-dinitrophenyl)-D-leucinamide is a chemical compound that inhibits the activity of proteases. It has been shown to inhibit leukemia cells and actinomycetes. This chemical binds to the active site of proteases, inhibiting the hydrolysis of peptides by blocking the access of water molecules to the reactive site. In addition, Nalpha-(5-fluoro-2,4-dinitrophenyl)-D-leucinamide can also be used as a fluorescent probe for protease activity in analytical methods. The product research on this compound has shown that it is a potent inhibitor of cyclic peptide synthetases and can be used as an anti-inflammatory agent.</p>

<p>Please enquire for more information about Amylin (8-37) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Bromoethanesulfonic acid sodium (2BESA) is a chemical inhibitor that is used to control methanogenic activity. It has been shown to be effective in the treatment of wastewater, although it is not very soluble in water. 2BESA inhibits methanogenesis by binding to the enzyme methane monooxygenase, which blocks electron transfer from methane to oxygen. This prevents the formation of hydrogen and carbon dioxide, which are products of fermentation. 2BESA also has electrochemical properties that make it a good candidate for use as an electrode material in fuel cells. In vitro assays have demonstrated that 2BESA inhibits bacterial growth by inhibiting DNA synthesis and protein synthesis.</p>

<p>Ac-Asp-Glu-Val-Asp-chloromethylketone trifluoroacetate salt is a basic protein. It inhibits the neuronal death induced by dopamine and its derivatives, which is caused by overactivation of the mitochondrial membrane potential and release of cytochrome c from mitochondria to cytosol. This compound also inhibits the activation of toll-like receptor 4 (TLR4) and nuclear factor κB (NF-κB) signaling pathways in neuronal cells. Ac-Asp-Glu-Val-Asp-chloromethylketone trifluoroacetate salt has been shown to have antiinflammatory effects when applied topically on skin wounds. The molecule has been used as a model system for studying the molecular mechanism of epidermal growth factor (EGF) activation in hybridoma cell lines and primary cells.</p>

<p>6-Hydroxy chlorzoxazone is a drug that interacts with 5-hydroxy omeprazole, cytochrome P450 (CYP2E1), and chlorzoxazone. This drug is not metabolized by CYP2E1, but is metabolized by liver microsomes. The plasma concentration of 6-hydroxy chlorzoxazone increases as the patient's body mass index increases. It has been shown to affect the activity of hepatic enzymes such as CYP2E1 and p450 in rat liver microsomes. 6-Hydroxy chlorzoxazone may be used for the treatment of bronchial asthma and chronic obstructive pulmonary disease. The kinetic data for 6-hydroxy chlorzoxazone are based on studies done on humans and rats.</p>

<p>4-(Bromomethyl)-3-chlorobenzonitrile is a radioactive compound that has no specific use. It is used for the production of butylamino, which is a precursor to various other compounds. 4-(Bromomethyl)-3-chlorobenzonitrile can be used as an unlabelled replacement for any other radioactive compound in a laboratory setting.</p>

<p>Please enquire for more information about (Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3,4-Dibromobenzoic acid ethyl ester is a high quality reagent that can be used as an intermediate for the synthesis of complex compounds. It is also useful as a building block for the synthesis of speciality chemicals and research chemicals. 3,4-Dibromobenzoic acid ethyl ester can be used in reactions such as Friedel-Crafts reactions, reducing reactions, and condensations. This chemical is a versatile building block that can be used to construct organic molecules with diverse structures. 3,4-Dibromobenzoic acid ethyl ester is a fine chemical with CAS number 60469-88-7.</p>

<p>Antagonist of 5-HT2A serotonin, α2-adrenergic and dopamine (D2) receptors</p>

<p>Please enquire for more information about Atrial Natriuretic Factor (5-27) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid b-Protein (1-40) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Arg2)-Dermorphin (1-4) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Methyl 2,2-difluoro-2-(fluorosulfonyl)acetate is a chemical that belongs to the group of halides. It has a redox potential of -0.274 V (vs SCE). The methyl group in this chemical is substituted with a fluoro group and a sulfonyl group. The methyl 2,2-difluoro-2-(fluorosulfonyl)acetate has been shown to have receptor activity with dopamine as its agonist. This chemical also has an aromatic hydrocarbon ring and an oxygen atom. Methyl 2,2-difluoro-2-(fluorosulfonyl)acetate has been shown to be effective against cancer cells and may have metabolic disorders such as diabetes mellitus type II and Alzheimer's disease.</p>

Please enquire for more information about Biotinyl-Tyr-Val-Ala-Asp-chloromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>Please enquire for more information about H-D-Val-Leu-Lys-chloromethylketone trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Tetraethylammonium bromide is an ionic liquid that has a low viscosity and high water solubility. It is used as an antimicrobial agent in the process of producing polymers, such as polyurethane. Tetraethylammonium bromide has been shown to be effective against a broad range of bacteria, including Bacillus subtilis and Escherichia coli. It has also been shown to have a protective effect on neurons by preventing neuronal death in response to oxidative stress. This protection may be due to its ability to increase the concentration of cytosolic Ca2+ ions, which are involved in neuronal survival pathways.</p>

<p>The compound H-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt is a synthetic antigen for use in the production of immunoadsorbent conjugates. It is a postulated fluorescence molecule that interacts with specific antibodies to form an antigen. This antigen can be used as a probe for detecting antibodies in biological fluids and tissues by fluorescence microscopy and has been shown to have no antigenicity in skin reactions.</p>

<p>Please enquire for more information about 6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a compound that can be used as a cancer treatment. It has been shown to inhibit the growth of human retinal pigmented epithelial cells (p. pastoris) and induce apoptosis in these cells. H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt interacts with the membrane of cells, blocking the binding site for growth factor and preventing the activation of downstream signaling pathways. This agent also binds to lysine residues on peptides, which are then degraded by proteases. H-Argo Arg Arg Arg Arg Arg Arg OH trifluoroacetate salt has been shown to have an affinity for flavone luteolin at neutral pH, as well as fatty acid molecules.</p>

<p>Please enquire for more information about 1-Fluoro-3-phenylpropan-2-amine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Gly-Ala-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Chloro-2,5-dibromopyridine is a fine chemical that is used as a building block in the synthesis of other chemicals. It is a reagent and speciality chemical with high quality and complex structure. 3-Chloro-2,5-dibromopyridine is a versatile building block that can be used in the synthesis of many different compounds and as an intermediate or scaffold for other reactions. It has been shown to react with various nucleophiles, such as amines, alcohols, and thiols.</p>

<p>Intermediate in the synthesis of mirabegron</p>

<p>Please enquire for more information about Arg-Glu(EDANS)-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (668-675)-Lys(DABCYL)-Arg trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Beta-MSH is a hormone that belongs to the peptide hormones group. It is synthesized in the pituitary gland and released in response to stress, trauma or injury. Beta-MSH has been shown to regulate many physiological functions, including adrenocorticotrophic hormone (ACTH) secretion, skin pigmentation and regulation of body temperature. Beta-MSH also has diagnostic applications as it can be used to measure levels of this hormone in cerebrospinal fluid (CSF). The n-terminal prohormone fragment of beta-MSH can be measured by radioimmunoassay (RIA) or enzyme immunoassay (EIA), while the c-terminal prohormone fragment can be measured by RIA.</p>

<p>Cefepime is a broad-spectrum antibiotic that is used to treat bacterial infections. It inhibits cell wall synthesis by binding to the penicillin-binding proteins and interfering with the cross-linking of peptidoglycan. Cefepime has been shown to be active against gram-negative pathogens such as Aeruginosa, Stenotrophomonas maltophilia, and P. aeruginosa. Cefepime also inhibits the growth of gram-positive bacteria such as Staphylococcus aureus, Enterococcus faecalis, and Streptococcus pneumoniae. The chemical structure of cefepime is similar to that of other beta-lactam antibiotics like methicillin, oxacillin, cloxacillin, ampicillin, and amoxicillin. Cefepime has been shown to be effective in treating resistant gram-negative organisms such as Pseudomonas aeruginosa (P.</p>

<p>Galnon trifluoroacetate salt is a pharmacological agent that binds to galanin and inhibits its binding to G protein-coupled receptors. It was shown to have a cancer preventive effect on 3T3-L1 preadipocytes by inhibiting the production of the inflammatory cytokine, tumor necrosis factor-α (TNF-α). Galnon trifluoroacetate salt also has an effect on the immune system and may be used as an anti-inflammatory agent in autoimmune diseases. This drug has been shown to block the effects of galanin on camp levels, leading to a decrease in locomotor activity.</p>

<p>2-Bromo-3-fluoroaniline is a reactive and nucleophilic compound that is synthesized by the reaction of aniline with bromine and sodium hydroxide. The drug development of 2-bromo-3-fluoroaniline has been hampered by its toxicity, but it has shown promising results in animal studies for the treatment of cancer. Mechanistic studies have demonstrated that 2-bromo-3-fluoroaniline causes cell death by reacting with DNA. This drug also acts as a prodrug to fluoroacetic acid, which inhibits cell proliferation by inhibiting protein synthesis.</p>

<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Alpha-Casein (90-96) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about DABCYL-Glu-Arg-Nle-Phe-Leu-Ser-Phe-Pro-EDANS trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-676)-Lys(Dnp)-Arg-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Sodium 2,3,5,6-Tetrafluoro-4-hydroxybenzenesulfonate is a synthetic compound that is used as a probe for catalytic reactions. It has been shown to be active in the oxidation of glycols and ethylene glycols. This compound is also useful for the tethering of metal atoms or ions. Sodium 2,3,5,6-Tetrafluoro-4-hydroxybenzenesulfonate can be used in catalysis due to its ability to act as an electron donor.</p>

<p>Please enquire for more information about Dynorphin A (1-13) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Osteostatin (1-5) (human, bovine, dog, horse, mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Lys-Gln-Lys-Leu-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about tert-Butyl6-[(1e)-2-[4-(4-fluorophenyl)-6-(1-methylethyl)-2-[methyl(methylsulfonyl)amino]-5-pyrimidinyl]ethenyl]-2,2-dimethyl-1,3-di oxane-4-acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH trifluoroacetate salt is a peptide that has been shown to inhibit the growth of tumor cells. It has also been shown to have biological properties in a number of experimental models, including in vitro and in vivo studies. H-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH trifluoroacetate salt inhibits muscle cell proliferation by binding to the extracellular matrix protein collagen type I. This inhibition leads to reduced tissue formation and body growth. This peptide also inhibits the proliferation of cancer cells by blocking the production of growth factor beta 1 (GFβ1).</p>

<p>Please enquire for more information about 1-(2-Fluorobenzyl)-1H-pyrazolo[3,4-b]pyridine-3-carboximidamide hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>13-mer connexin mimetic peptide, composed of residue numbers 63-75 of the first extracellular loop of connexin 43 (gap junction blocker), containing the SHVR amino acid motif.</p>

<p>Please enquire for more information about Prion Protein (106-126) (human) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HIV-1 tat Protein (49-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Urocortin II (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Osteostatin amide trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PAR-2 is a cytosolic protein that is activated by calcium. PAR-2 activation induces the synthesis of prostaglandins and other inflammatory mediators, which stimulate the release of substances from cells such as cytokines and chemokines. PAR-2 also has an important role in cell proliferation, differentiation, apoptosis, and cancer development. PAR-2 activation is induced by proteases such as trypsin or soybean trypsin inhibitor. The trifluoroacetate salt form of PAR-2 (1-6) has been used to inhibit protease activity in colon cancer cells and prostate cancer cells.<br>PAR-2 (1-6) (human) trifluoroacetate salt H-Ser-Leu-Ile-Gly-Lys-Val-OH trifluoroacetate salt is a potent chemical inhibitor of trypsin activity with IC50 values of 0.5 µM for soybean trypsin inhibitor</p>

<p>Please enquire for more information about Methyl 3-oxo-4-(2,4,5-trifluorophenyl)butanoate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cortistatin-29 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Gln22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1-Hydroxy-6-(trifluoromethyl)benzotriazole is a chemical compound that is used as a reagent and an additive in organic synthesis. It has been shown to react with the 7-aminocephalosporanic acid to form a reactive molecule, which is then acylated with various amines. The reaction time can be modified by adding certain additives, such as chloride or uridine. 1-Hydroxy-6-(trifluoromethyl)benzotriazole is also a solid phase synthesis, which means it reacts with other molecules during the synthesis process to form new substances. It also has acidic properties, and can act as a nucleophile in the presence of aminocephalosporanic acid. The structural formula for this chemical is shown below:</p>

<p>Please enquire for more information about Biotinyl-Neuromedin S (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid Dan Protein (1-34) (reduced) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Gly-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Lys(Dnp)-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ala-Pro-pNA hydrochloride salt is a protease inhibitor that is used as a therapeutic agent for the treatment of hepatitis C. It has been shown to inhibit the activity of serine proteases, such as trypsin and chymotrypsin, by binding to their active site. H-Ala-Pro-pNA hydrochloride salt also inhibits the activity of DPPIV (dipeptidyl peptidase IV), which is an enzyme that cleaves the third amino acid from peptides in some blood cells. H-Ala-Pro-pNA hydrochloride salt has been shown to be effective in preventing diabetic nephropathy in animal models by inhibiting DPPIV activity.<br>H-Ala-Pro-pNA hydrochloride salt can be used to treat chronic hepatitis B and C infections. It binds to virus particles and prevents them from attaching themselves to host cells, thus preventing viral replication.</p>

<p>6-Bromohexanoic acid methyl ester is a linker that can be used in the synthesis of amides. This compound is synthesized by reaction between 2-bromobutyric acid and malonic acid, followed by hydrolysis with sodium hydroxide. 6-Bromohexanoic acid methyl ester is an efficient method for the preparation of amides. It is biologically active and has been shown to have anti-inflammatory properties in biological studies.</p>

<p>Please enquire for more information about Biotinyl-MCH (salmon) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-Lys-tBu-Gly-Cys-2-Nal-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Osteostatin is a recombinant human protein that inhibits bone growth by binding to and neutralizing the effect of forskolin. Osteostatin also has an inhibitory effect on cancer cells, as it inhibits mitochondrial pathways and prevents the activation of factor receptors. Osteostatin blocks the synthesis of cAMP, which is necessary for cell proliferation in cancer cells. The inhibition of cAMP levels leads to a decrease in the production of proteins that stimulate bone growth, such as runx2.</p>

<p>3,5-Dichlorobenzenesulphonyl chloride (3,5-DCBS) is a halogenated aromatic compound that can be synthesized by the debromination of 3,5-dichlorobenzene with hydrobromic acid. This compound has been shown to have anticancer activity against cell lines derived from human breast cancer, prostate cancer, and other cancers. It also has potent anticancer activity against tumor cells in animals. The anticancer activity of 3,5-DCBS is due to its ability to inhibit DNA synthesis and to induce apoptosis. 3,5-DCBS may act as an anti-inflammatory agent through inhibition of prostaglandin synthesis.</p>

<p>Please enquire for more information about pTH (1-84) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Arg-AMC hydrochloride salt is a proteolytic agent that inhibits serine proteases. It can be used to study the biological function of proteases and as a tool in the kinetic analysis of protease activity. Z-Arg-AMC hydrochloride salt has been shown to inhibit trypsin, chymotrypsin, and elastase enzymes at nanomolar concentrations. This compound also inhibits human pathogens such as enterovirus 71 and herpes simplex virus type 1, which are associated with severe disease symptoms. The structural analysis of Z-Arg-AMC hydrochloride salt has shown it to be a racemic mixture of L-Arginine and D-Arginine with an average molecular weight of 313.5 Da.</p>

<p>5-Chloro-2-nitrodiphenylamine is a synthetic dyestuff that belongs to the class of acridones. It can be used as an anti-epileptic drug, although it has not been approved for this use in any country. 5-Chloro-2-nitrodiphenylamine is manufactured by reacting a 6-carboxylic acid with an organic solvent and ammonolysis. This chemical is also known as 6'-chloroacridone and is used in the production of dyes and pigments. The manufacturing process produces impurities such as chloride, which must be removed by evaporation. Nitro groups are introduced during the manufacturing process to improve the dye's stability and color fastness under light exposure.</p>

<p>4-Fluoromethyl-alpha-methylbenzyl alcohol is a nonclassical molecule that has been synthesized. This molecule has been modeled computationally and the results indicate that it exhibits a planar geometry with a diastereomeric ratio of 1:1. The theoretical calculations show that the reaction of 4-fluoromethyl-alpha-methylbenzyl alcohol with water is exothermic, which would result in the formation of an intermediate hydroxide ion. Kinetic studies have shown that this molecule can undergo transfer reactions and dehydrogenation reactions, both of which are possible mechanisms for its reactivity.</p>

<p>(Trifluoromethylthio) silver(I) is an efficient method for the synthesis of chiral, functionalized organosulfur compounds. It is prepared by the trifluoromethylthiolation of aryl acetonitriles in the presence of persulfate and a radical coupling agent. The reaction time can be adjusted to suit the desired product, with shorter times producing more complex molecules. This compound can be used as a nucleophile in organic reactions, including sulfide activation reactions.</p>

<p>Please enquire for more information about 4-Chlorophenyl-2-pyridinylmethanol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Cyclopropylmethoxy-4-difluoromethoxy-benzoic acid is an industrial chemical that is used as a binding agent in the production of dyes, rubber, and pharmaceuticals. The compound is produced by the acylation of 3-chloromethoxybenzoic acid with cyclopropylmethanol. This reaction requires an inorganic base such as potassium carbonate or sodium bicarbonate to activate the chloride. 3-Cyclopropylmethoxy-4-difluoromethoxybenzoic acid can be used as a reactive alkylating agent for the production of amides and other organic compounds, which increases its versatility.</p>

<p>4(5)-Iodoimidazole is a chemical compound that is used in the synthesis of other compounds. It can be synthesized by cross-coupling reactions with 4-iodoaniline and 4-bromoimidazole. The reaction yields are high, and this method has been shown to be an efficient method for the synthesis of 4(5)-iodoimidazole. This compound has antibacterial activity against bacterial strains such as Escherichia coli and methicillin-resistant Staphylococcus aureus.</p>

<p>3-Fluorobenzophenone is a functionalized organic compound that can be synthesized by the reaction of potassium t-butoxide with 3-fluorobenzaldehyde. This chemical has been shown to have vibrational bands in the infrared region of the electromagnetic spectrum. The protonation and acidic properties of 3-fluorobenzophenone were confirmed by control experiments involving hydrogenation reactions with carboxylic acids and nucleophilic acetonitrile, respectively.<br>3-Fluorobenzophenone is soluble in water and alcohols, but insoluble in ethers; it is stable under normal conditions, but decomposes when heated or exposed to UV light.</p>

<p>Please enquire for more information about 6-Fluoro-3,4-Pyridinediamine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about trans-4-Hydroxy-D-proline hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Met-Cys-Glu-Lys-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about FITC-epsilonAhx-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is a chemical compound that belongs to the group of apoptosis proteins. It has been shown to have anti-inflammatory and neuroprotective effects in primary cells, as well as to induce apoptosis in HL60 cells. Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is also able to inhibit the activation of the caspase pathway by preventing the release of cytochrome c from mitochondria and decreasing the mitochondrial membrane potential. The protein may be used as an agent for skin cancer treatment.</p>

<p>3,5-Diiodo-4-methoxybenzhydrazide is a high quality chemical that is useful in the preparation of complex compounds. This compound has been shown to be an excellent reagent and useful intermediate for the synthesis of various fine chemicals. It has been used as a precursor for the production of the antiviral drug Tamiflu, among other pharmaceuticals. 3,5-Diiodo-4-methoxybenzhydrazide is also a versatile building block that can be used in research or as a reaction component in organic synthesis.</p>

<p>Please enquire for more information about Octreotide trifluoroacetate salt (Dimer, Antiparallel) ( including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Chloro-N-[2-(diethylamino)ethyl]-4-quinolinecarboxamide is a carboxamide analog of dibucaine. It is synthesized from chloroacetyl chloride and isatin in the presence of sodium hydroxide. The synthesis has been scaled to an industrial level. 2-Chloro-N-[2-(diethylamino)ethyl]-4-quinolinecarboxamide has been shown to have analgesic properties, similar to those of dibucaine. Radiolysis of this compound gives a carboxylic acid and a heterocyclic ring product.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>3,5-Dimethoxybenzyl bromide is a difluoro compound that has been synthesized as a potential CB2 receptor agonist. It has been shown to bind to both CB1 and CB2 receptors in cell culture. 3,5-Dimethoxybenzyl bromide has also been shown to inhibit the growth of mouse melanoma cells by inducing apoptosis and cell cycle arrest, which may be due to its ability to demethylate pterostilbene derivatives. 3,5-Dimethoxybenzyl bromide is an example of a nucleophilic agent because it can donate a proton from the hydroxyl group on the benzene ring. The chloride ion forms an ionic bond with the negatively charged oxygen atom on the benzoic acid group. This type of bond is called an ester linkage or ester bond.</p>

<p>3,5-Bis(trifluoromethyl)benzaldehyde is a synthetic compound that has been shown to inhibit cancer cell growth. It is a chromatographic reagent and an intermediate in the production of pharmaceuticals. 3,5-Bis(trifluoromethyl)benzaldehyde was shown to bind to the amino group of proteins and inhibit the synthesis of protein inhibitors. This compound also binds to cholesterol esters and causes lipid peroxidation, leading to cell death in cancer cells.</p>

<p>Please enquire for more information about (Des-Gly10,D-His2,D-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>