Bioquímicos e reagentes

<p>ELISA kit for the detection of Mac2BP in the research laboratory</p>

<p>ELISA kit for detection of MMP2 in the research laboratory</p>

<p>Please enquire for more information about 3,7,11,15,19,23,27,31,35-nonamethyl-2E,6E,10E,34-hexatriacontatetraene-1,15,19,23,27,31-hexol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>This product has disulfide bonds between Cys1-Cys15 and Cys3-Cys11 and is available as a 0.1mg vial. Big Endothelin-1 (Human, 1-38) is part of the full lengthed 29 amino acid peptide Big Endothlin-1 which is a precursor peptide of the vasoconstrictorEndothelin-1 (ET-1). ET-1 exhibits vasoconstrictive properties and is an activator of endothelin G-protein coupled receptors. Furthermore ET-1 is produced when inflammation, vascular stress or hypoxia occurs. In vivo Big Endothelin-1 has a greater half life compared to ET-1 and therefore makes it useful to study secretory activity in the endothelial system.<br>Overall Big Endothelin-1 (Human, 1-38) can be used as a research tool for studying protein interactions, receptor activation and function, and ligand binding. This peptide is also used in pharmacology to study the effects of therapeutic agents on receptor activity and expression.</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>Sodium pyrophosphate decanhydrate is a methyltransferase inhibitor that blocks the enzyme form of the DNA methyltransferase, which is responsible for maintaining DNA methylation patterns. It has been shown to inhibit the enzymatic activity of this enzyme in a model system. Sodium pyrophosphate decanhydrate inhibits the growth of bacteria by binding to water molecules and preventing them from binding to other molecules, causing dehydration. This drug also has potential as a natriuretic peptide levels inhibitor, with electrochemical impedance spectroscopy studies showing that it may have a high affinity for sodium ions. Studies have also shown that sodium pyrophosphate decanhydrate has no toxicity in mice.</p>

<p>Bisoprolol is a peptide that binds to the beta-adrenergic receptor and is used as a research tool to study the pharmacology of this receptor. Bisoprolol is a selective beta-1 receptor antagonist, which can inhibit the activation of this receptor. It has been shown to inhibit tumor growth in mice by inhibiting protein interactions with cell membranes, which decreases calcium levels in cells. The main mechanism of action for bisoprolol is through inhibition of protein interactions with cell membranes, which leads to decreased intracellular calcium levels and subsequent inhibition of cellular processes such as protein synthesis.</p>

<p>Rapalink-1 is a gene therapy drug that has been shown to be effective against resistant mutants of malignant brain tumors. Rapalink-1 is a protein that has been engineered to bind to mesenchymal markers and inhibit the progression of cancer cells. This protein also has the ability to induce autophagy, which can lead to axonal growth and help with ischemia–reperfusion injury in pediatric patients. Rapalink-1 inhibits tumor growth by triggering autophagy, which can lead to axonal growth and help with ischemia–reperfusion injury in pediatric patients. Rapalink-1 is an autophagy inducer that binds to mesenchymal markers on cancer cells and inhibits the progression of cancer cells. It also has the ability to induce autophagy, which can lead to axonal growth and help with ischemia–reperfusion injury in pediatric patients.</p>

<p>Insulin is a peptide hormone that is produced by beta cells in the pancreas. Insulin has several important functions, including regulation of blood sugar levels, lipid metabolism and protein synthesis. It is also involved in the regulation of cellular growth and proliferation. Insulin binds to insulin receptors on the surface of cells, activating them and allowing for the uptake of glucose into cells and storage as glycogen. Insulin is a ligand for the insulin receptor. It can also bind to other receptors, such as IGF1R, which causes activation of PI3K/AKT pathway. Insulin is an antibody that can be used as research tool or cell biology reagent.<br>INSULIN CAN BE USED TO:<br>- Measure blood sugar levels<br>- Monitor diabetes<br>- Treat diabetes<br>- Control weight gain<br>- Improve muscle mass</p>

<p>Please enquire for more information about Mouse SAA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mouse anti-Brucella abortus antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dysprosium(III) bromide is an ionic compound that is an essential component of many high-temperature superconductors. This compound has a stoichiometric ratio of 1:1, which means that the number of dysprosium atoms in the formula is equal to the number of bromide ions. The experimental transport properties for this compound have been determined using a series of experiments. Transport activity coefficients and transition temperatures were calculated using quadratic equations. The solubility data for Dysprosium(III) bromide has been determined at several temperatures, as well as its eutectic point and melting point constants.</p>

<p>Neutrophil Gelatinase Associated Lipocalin (NGAL) is a lipocalin protein that is involved in many physiological and pathophysiological processes. NGAL binds to bacterial products, such as lipopolysaccharide, and can be used as a biomarker for inflammation or infection. NGAL has been shown to be elevated in the urine of patients with urinary tract infections. Additionally, NGAL has been shown to be associated with neurological diseases, such as Alzheimer's disease and Parkinson's disease. The recombinant human form of this protein can be used for research purposes or for the development of diagnostic tools. Neutrophil Gelatinase Associated Lipocalin (NGAL) is a lipocalin protein that is involved in many physiological and pathophysiological processes. It binds to bacterial products, such as lipopolysaccharide, and can be used as a biomarker for inflammation or infection. NGAL has been shown to be elevated in the urine of patients</p>

<p>ILK-IN-2 is a molecule that inhibits autophagy in leukemia cells. It has been shown to be effective in inhibiting the growth of meningioma and lymphocytic leukemia cells. ILK-IN-2 has also shown inhibitory properties against chronic lymphocytic leukemia and primary cells, which may be due to its ability to induce apoptosis by activating proapoptotic molecules such as Bax, Bak, and caspase-3. In addition, ILK-IN-2 has demonstrated anti-inflammatory properties that may lead to its use in autoimmune diseases.</p>

<p>β-Sinensal is an analog of astaxanthin that has shown potent inhibitory activity against human kinases. This compound has been shown to induce apoptosis in cancer cells and inhibit tumor growth in Chinese hamsters. β-Sinensal has also been found in human urine, suggesting that it may have a role in regulating cellular replication. In addition, this compound has demonstrated synergistic effects with methotrexate, a commonly used cancer drug. β-Sinensal is a promising inhibitor of kinases and may have potential as a therapeutic agent for the treatment of cancer.</p>

<p>SR-4370 is a potent inhibitor of the histone deacetylase (HDAC) enzyme class. It has been shown to inhibit cholesterol synthesis and lipid biosynthesis in cells, as well as inhibiting cancer cell proliferation. SR-4370 also has antioxidant effects, which may be due to its ability to inhibit the activation of NF-κB and downstream mediators. In addition, this compound has been shown to have synergistic effects with other HDAC inhibitors and chemotherapy drugs. This drug is being developed for the treatment of cancers such as prostate cancer, melanoma, breast cancer, colon cancer, and head and neck cancer.</p>

<p>Please enquire for more information about Hamster (CHO) GTP-binding Nuclear Protein (RAN) ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Human Myoglobin ELISA Kit</p>

<p>Please enquire for more information about Human Myeloperoxidase (MPO) ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Leptin is a cell-signalling hormone vital in the regulation of appetite, food intake and body weight. Studies have shown that an absence of leptin in the body or leptin resistance can lead to uncontrolled feeding and weight gain. Because obesity is an established risk factor in various cancers and leptin plays a significant role in the physiopathology of obesity, the exploration of leptin's link to cancer risk is of considerable importance.</p>

<p>Cat SAA ELISA Kit - For the quantitative determination of serum amyloid A (SAA) in feline samples.</p>

<p>HRP-IgG conjugation kit utilizes a novel chemistry to generate highly reproducible IgG-HRP conjugates with a simple procedure. The resulting conjugates have been shown to be extremely stable, retaining 100% activity after storage for 60 days at 37º C with concentrations as low as 0.5 μg/mL.Features:<br><br>Liquid-based reagents-No reconstitution, just Mix and Go.<br>Completely scaleable – Conjugate anywhere from 0.1 to 1 gram IgG per reaction.<br>Supplies sufficient activated HRP to conjugate all IgG at a 4:1 HRP:IgG ratio.<br>Highly efficient HRP incorporation – conjugate purification not usually necessary.<br>Customize the HRP:IgG ratio to create optimized conjugates for different applications.</p>

<p>ELISA kit for the detection of Chlamydia Pneumoniae IgA in the research laboratory</p>

<p>ELISA kit for the detection of Dopamine in the research laboratory</p>

<p>PBB 10 is a monoclonal antibody that binds to the antigen on the surface of cells. It is used in immunocytochemical staining and immunohistochemical staining techniques, as well as in ELISA assays. PBB 10 can be used for the detection of brominated biphenyls (PBBs) in liquid samples that are either incubated or not incubated with a brominating agent. PBB 10 can be used for the detection of polychlorinated biphenyls (PCBs) in dry samples that are debrominated before analysis. The antibody is also useful for detecting PCBs in tissues from laboratory animals. PBB 10 stains neural tissue and has been shown to be a ligand for certain receptors in the nervous system.</p>

<p>ELISA Kit for detection of PGD2 in the research laboratory</p>

<p>ELISA kit for detection of Laminin in the research laboratory</p>

<p>Rat Beta 2-Microglobulin ELISA Kit<br>Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.</p>

<p>ELISA kit for the detection of MicroAlbumin in the research laboratory</p>

<p>ELISA kit for detection of Lipocalin 2 in the research laboratory</p>

<p>ELISA kit for detection of CXCL10 in the research laboratory</p>

<p>ELISA Kit for detection of PDGFAB in the research laboratory</p>

<p>ELISA kit for the detection of TNF alpha in the research laboratory</p>

<p>ELISA kit for detection of Mouse RANKL in the research laboratory</p>

<p>ELISA kit for detection of Rat PAI1 in the research laboratory</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SYNCRIP antibody, catalog no. 70R-1335</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (PE)</p>

<p>ELISA Kit for detection of TPO in the research laboratory</p>

<p>ELISA kit for detection of Rheumatoid Factor IgG in the research laboratory</p>

<p>ELISA Kit for detection of PGF2a in the research laboratory</p>

<p>ELISA kit for the detection of Leptin Receptor in the research laboratory</p>

<p>ELISA Kit for detection of Prolactin in the research laboratory</p>

<p>Histamine ELISA Kit for the quantitative determination of Histamine in plasma and urine</p>

<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>

<p>Mouse monoclonal METTL21A antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf131 antibody, catalog no. 70R-4090</p>

<p>Mots-C is a mitochondrial-derived peptide, which is encoded by the small open reading frame found within the mitochondrial 12S rRNA. This peptide functions by interacting with the cellular metabolic pathways to enhance mitochondrial bioenergetics and overall cellular metabolism. Mechanistically, Mots-C modulates the folate–methionine cycle, directly impacting glucose regulation and energy utilization, and consequently facilitating cellular adaptation to metabolic stress.</p>

<p>CD152 antibody (PE) was raised in hamster using murine CD152/CTLA-4 as the immunogen.</p>

<p>CD30 antibody (FITC) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.</p>

<p>(4bS,8aS,9S,10S)-10-(Acetyloxy)-3,9-bis(benzoyloxy)-4b,5,6,7,8,8a,9,10-octahydro-4b,8,8-trimethyl-2-(1-methylethyl)-1,4-phenanthrene dione is a potent chemokine molecule that is an agonist of the CXCR2 receptor. It has been shown to inhibit cancer stem cells and chemoattractant production in colon carcinoma cells. This compound selectively targets the translation of lamiaceae mRNA and induces apoptosis in colon carcinoma cells.</p>

<p>p-Perfluoroterphenyl is a potent inhibitor of kinases, which are enzymes that play a crucial role in the regulation of cell growth and division. This compound has been extensively studied in Chinese medicinal research for its anticancer properties. It has been shown to inhibit the growth of tumor cells and induce apoptosis, or programmed cell death, in cancer cells. Additionally, p-Perfluoroterphenyl has been found to be an effective inhibitor of protein kinases, which regulate many important cellular processes. This analog has also been detected in human urine samples, indicating its potential as a diagnostic tool for cancer detection and treatment. Overall, p-Perfluoroterphenyl is a promising new compound with potential applications in cancer therapy and diagnosis.</p>

<p>Custom research peptide; min purity 95%.</p>

<p>SNIPER(ABL)-058 is a cutting-edge selective protein degrader, developed from the field of chemical biology. It is based on a bifunctional small molecule that acts as a degrader by recruiting the ubiquitin-proteasome system to specifically tag the target protein for degradation. This compound is synthesized through precise chemical modifications designed to form specific interactions with its target, namely the BCR-ABL protein, a critical driver in certain cancer pathways.</p>

<p>Purified Cat/Feline Haptoglobin</p>

<p>Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.</p>

<p>Interleukin 6 (IL-6) is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha.</p>

<p>Recombinant SARS-CoV-2 Nucleocapsid Protein (GenBank# QHD43423.2, a.a.1-419) with a 6xHIS tag was expressed in E. coli and purified by nickel affinity chromatography.</p>

<p>The Goat IgG ELISA kit is intended for the quantitative determination of total goat IgG in biological samples. This product will not react with sheep IgG or Bovine IgG.</p>

<p>Mouse TNF-alpha ELISA Kit</p>

<p>ELISA Kit for detection of MMP2 in the research laboratory</p>

<p>Please enquire for more information about Rat CRP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA Kit for detection of IL17 in the research laboratory</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein</p>

<p>Adrenaline/Noradrenaline/Dopamine ELISA Kit for the rapid quantitative determination of Adrenaline/Noradrenaline/Dopamine in plasma</p>

<p>Bovine Lactoferrin ELISA Kit</p>

<p>ELISA kit for detection of Human IL6 in the research laboratory</p>

<p>ELISA kit for the detection of cAMP in the research laboratory</p>

<p>Ovotransferrin is an acute-phase protein with iron-binding and immunomodulatory functions.</p>

<p>Mouse monoclonal MGLL antibody</p>

<p>ELISA kit for the detection of IGFBP1 in the research laboratory</p>

<p>ELISA kit for detection of EGFR in the research laboratory</p>

<p>ELISA Kit for detection of Free Triiodothyronine in the research laboratory</p>

<p>ELISA kit for the detection of CRP in the research laboratory</p>

<p>Please enquire for more information about 1,9-Dichloro-3,7-diazanonane dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Tosedostat-d5 is an analog of Tosedostat, an anticancer drug that inhibits the activity of a variety of kinases involved in cancer cell growth and survival. This compound has been shown to induce apoptosis in human cancer cells and has demonstrated promising results in preclinical studies. Tosedostat-d5 is labeled with five deuterium atoms, which makes it useful as a tracer for pharmacokinetic and metabolic studies. It is also used as a tool for investigating the metabolism of other drugs, such as rifampicin and astaxanthin, in Chinese hamster ovary cells. Inhibitors of tosedostat-d5 have been developed for use in cancer therapy, making this compound an important tool for research into new anticancer treatments.</p>

<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>

<p>ELISA kit for the detection of Cardiolipin screen IgG/IgM/IgA1 in the research laboratory</p>

<p>Rituximab is a chimeric monoclonal antibody used in the treatment of some cancers like CD20 non-Hodgkin's lymphoma and a few autoimmune conditions such as rheumatoid arthritis. However, antibody treatment can lead to generation of neutralising antibodies thus curtailing the efficacy of the therapy. CD 4+ T cells are critical to initiate antibody response so identification of epitopes within molecules using T cell assays can be a vital tool for understanding the immune response and thereby prevent induction of neutralising antibodies. Within rituximab, the variable region of the light chain (41-55) was found to have strong affinity for leukocytes in a specific binding assay, the epitope was also correlated to patients who developed neutralising antibodies. This T cell epitope within rituximab in further immune studies could help design or selection of antibodies without T cell epitopes present for low immunogenicity.</p>

<p>Thymus peptide C is a peptide that is an inhibitor of Protein interactions. It binds to the receptor and activates the Ligand, which then inhibits ion channels. Thymus peptide C has been used as a research tool to study the inhibition of ion channels in cells. This peptide has also been used as an antibody for the detection of antigens that are associated with cell proliferation.</p>

<p>ELISA kit for detection of Laminin in the research laboratory</p>

<p>ELISA kit for the detection of LH in the research laboratory</p>

<p>ELISA kit for the detection of Sperm Antibodies in the research laboratory</p>

<p>ELISA Kit for detection of Calcitonin in the research laboratory</p>

<p>ELISA Kit for detection of MMP2 in the research laboratory</p>

<p>Human IgG &amp; IgM Primer Set</p>

<p>ELISA kit for the detection of ANA in the research laboratory</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (allophycocyanin)</p>

<p>ELISA Kit for detection of IL17 in the research laboratory</p>

<p>Monkey Red Blood Cells are a valuable resource in the field of Life Sciences. These cells can be used for various applications such as studying the angiotensin-converting enzyme, neutralizing antibodies, and electrode development. Monkey Red Blood Cells are often used in research to develop monoclonal antibodies and pegylated products. They can also be used as biospecimens for the analysis of serum, plasma, and other fluids. Additionally, Monkey Red Blood Cells have been utilized in studies involving collagen, human serum, peptide agents, influenza hemagglutinin, brucella abortus, carbon quantum dots, chemokines, and growth factors. These cells offer researchers a reliable and versatile tool for their scientific investigations.</p>

<p>ELISA kit for the detection of Human GCSF in the research laboratory</p>

<p>ELISA kit for the detection of NGAL in the research laboratory</p>

<p>ELISA kit for the detection of Estradiol in the research laboratory</p>

<p>ELISA kit for the detection of SSA in the research laboratory</p>

<p>VMAT2 antibody was raised in rabbit using a synthetic peptide from C-terminus of rat VMAT2 conjugated to BSA as the immunogen.</p>

<p>ELISA Kit for detection of IgA in the research laboratory</p>

<p>ELISA kit for the detection of EPO in the research laboratory</p>

<p>CEA antibody was raised in mouse using human colon adrenocarcinoma as the immunogen.</p>

<p>Custom research peptide; min purity 95%.</p>

<p>ELISA kit for the detection of IL1 beta in the research laboratory</p>

<p>ELISA Kit for detection of leukotriene E4 in the research laboratory</p>

<p>GRK5 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>ELISA kit for detection of BDNF in the research laboratory</p>

<p>Inhibitor of p38 MAPK kinase</p>

<p>ELISA Kit for detection of Angiostatin K13 in the research laboratory</p>

<p>RGH-5526 is a peptide that activates the immune system. It is an inhibitor of protein interactions and has been shown to inhibit receptor signaling, ligand binding, and ion channels. The peptide has also been shown to be a high-purity product with CAS No. 69579-13-1. This product can be used as a research tool in cell biology and pharmacology studies.</p>

<p>Please enquire for more information about Dog IgG ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>IgG is a type of antibody that plays a crucial role in the immune system. IgG antibodies are produced by plasma cells and are the most abundant type of antibody found in the bloodstream and tissues. They are involved in recognizing and neutralizing pathogens such as bacteria and viruses, as well as in activating other components of the immune system. IgG antibodies also play a role in immune responses to vaccines and in providing passive immunity, such as through maternal antibodies transferred to infants during breastfeeding. Human IgG ELISA Kit accurately allows for rapid quantification of total IgG in your biological samples.</p>

<p>GPR116 antibody was raised in Rabbit using Human GPR116 as the immunogen</p>

<p>ELISA Kit for detection of Thyroxine in the research laboratory</p>

<p>ELISA kit for detection of Testosterone in the research laboratory</p>

<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>

<p>ELISA kit for the detection of Prothrombin IgG/IgM in the research laboratory</p>

<p>ELISA Kit for detection of IgA in the research laboratory</p>

<p>ELISA Kit for detection of Perforin 1 in the research laboratory</p>

<p>Recombinant Mouse MASP2 protein</p>

<p>Biotin labeling kit for IgG</p>

<p>ELISA Kit for detection of PPARa in the research laboratory</p>

<p>ELISA Kit for detection of beta 2 Microglobulin in the research laboratory</p>

<p>Adrenaline/Noradrenaline ELISA Kit for the rapid quantitative determination of Adrenaline/Noradrenaline in plasma</p>

<p>ELISA kit for detection of Dihydrotestosterone in the research laboratory</p>

<p>ELISA Kit for detection of Prolactin in the research laboratory</p>

<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>

<p>ELISA kit for the detection of Phospholipid Screen IgG/IgM in the research laboratory</p>

<p>Please enquire for more information about Human Fibrinogen ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dog Osteopontin ELISA Kit - OPN is confined to the distal parts of a subset of nephrons. In the kidney the expression of OPN is severely upregulated during renal injury.Â</p>

<p>Rat Myoglobin ELISA Kit</p>

<p>Human Apolipoprotein H ELISA Kit</p>

<p>Ready to use Dog/Canine Cystatin C ELISA Kit</p>

<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.</p>

<p>Please enquire for more information about Mouse Alpha 1-Antitrypsin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Monkey Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Rat Transferrin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Highly sensitive Mouse Albumin ELISA kits are for the measurement of albumin in your samples. The kits are complete with ready to use reagents necessary to perform the assays.</p>

<p>Horse Haptoglobin ELISA Kit</p>

<p>The Monkey IgM ELISA kit is intended for the quantitative determination of total monkey IgM (new and old world) in biological samples.</p>

<p>Please enquire for more information about Human Lactoferrin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rat Thiostatin ELISA Kit</p>

<p>Neurokinin A is a peptide that is derived from the precursor protein, preprotachykinin A, and has been found to be an endogenous ligand for the NK-1 receptor. It is involved in a wide range of physiological processes such as neurotransmission and regulation of blood pressure. Neurokinin A has been shown to inhibit adenylate cyclase activity in guanethidine-sensitive tissues and ionophores-resistant cells. The effects of Neurokinin A are not due to its ability to bind to the NK-1 receptor but rather through other mechanisms. The amino acid sequence of this peptide was first determined by cloning methods in 1984 and it has since been used extensively as a tool for studying the function of this receptor. Neurokinin A also inhibits cell proliferation in glioma cells and has been shown to have an inhibitory effect on Ca2+ concentration during electrical nerve stimulation.</p>

<p>Hamster (CHO) Legumain ELISA Kit<br> <br>Legumain is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Legumain, a lysosomal protease, cleaves the asparaginyl and aspartyl bonds of therapeutic monoclonal antibodies, thus compromising their integrity, stability, and efficacy.</p>

<p>Hamster (CHO) Nidogen-1 ELISA Kit<br> <br>Nidogen-1 is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Nidogen-1 interacts with the Fc region of therapeutic monoclonal antibodies and is particularly difficult contaminant to remove even after polishing steps.</p>

<p>Cat IgE ELISA Kit</p>

<p>Please enquire for more information about CHO LPLA2 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human Albumin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.</p>

<p>Please enquire for more information about Mouse KIM-1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rat Plasminogen ELISA Kit</p>

<p>Human IgD ELISA Kit</p>

<p>Please enquire for more information about Mouse Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>IgY, or immunoglobulin Y, is a type of antibody found in the immune systems of birds, reptiles, and amphibians. It serves a similar function to IgG in mammals. In birds, IgY is the primary antibody found in serum, egg yolk, and other bodily fluids, whereas in mammals, IgG is the predominant antibody. IgY antibodies are important for providing passive immunity to offspring through the transfer of antibodies from the mother to the egg yolk, similar to how mammals transfer antibodies through the placenta or breast milk. IgY antibodies have also been used in research and diagnostic applications due to their specificity and ability to be harvested from egg yolks.</p>

<p>Please enquire for more information about Human SAA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bovine IL-6 ELISA Kit</p>

<p>This Monoclonal anti-TGEV antibody is suitable for ELISA and blotting applications. Reactivity observed with CCV.</p>

<p>Please enquire for more information about Human A2M ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Guinea Pig IgA ELISA Kit</p>

<p>Human NGAL ELISA Kit</p>

<p>Pig IgA ELISA Kit</p>

<p>Please enquire for more information about Human Alpha 1-Antitrypsin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Mouse Retinol Binding Protein ELISA Kit</p>

<p>Horse IgA ELISA Kit</p>

<p>Please enquire for more information about Human Apolipoprotein A1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Human Kappa ELISA Kit</p>

<p>Azido-dPEG®3-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®3-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

<p>ELISA Kit for detection of VEGFR2 in the research laboratory</p>

<p>Bestatin-amido-Me is a high purity, water soluble, and stable small molecule that can be used as a pharmacological research tool. It has been shown to inhibit protein interactions with receptors in the human body. Bestatin-amido-Me is also an inhibitor of ion channels and ligands for antibodies. This substance has been shown to inhibit receptor activation by peptides or other ligands at concentrations of 1mM or less. The chemical name for this substance is bestatin amide methylamide hydrochloride and its CAS number is 339186-54-8.</p>

<p>ELISA kit for the detection of OPG in the research laboratory</p>

<p>ELISA kit for the detection of CA 199 in the research laboratory</p>

<p>Custom research peptide; min purity 95%.</p>

<p>Mesotocin is a peptide hormone that has a role in the regulation of water permeability and estradiol benzoate. It also regulates the physiological functions of the brain and has been shown to be involved in congestive heart failure, as it causes an increase in blood pressure. Mesotocin is found at high levels in human serum, but its activity is dependent on the presence of other hormones such as estradiol benzoate. The biological properties of mesotocin are largely unknown, although it is known to have receptor activity. The effects of this hormone on the kidney have been studied using mesotocin trifluroacetate (MTFA) and monoclonal antibody (mAb). MTFA causes an increase in glomerular filtration rate (GFR), which may be due to its ability to inhibit angiotensin II-induced vasoconstriction and decrease vascular resistance.</p>