Bioquímicos e reagentes
Os bioquímicos e reagentes são substâncias fundamentais para a pesquisa e desenvolvimento em campos como biotecnologia, biologia molecular, farmacologia e medicina. Esses produtos são essenciais para uma variedade de aplicações, incluindo a síntese de compostos, a análise de amostras biológicas, a pesquisa de processos metabólicos e a produção de medicamentos. Na CymitQuimica, oferecemos uma ampla seleção de bioquímicos e reagentes de alta qualidade e pureza, adequados para diversas necessidades científicas e industriais. Nosso catálogo inclui enzimas, anticorpos, ácidos nucleicos, aminoácidos e muitos outros produtos, todos projetados para apoiar pesquisadores e profissionais em seus projetos de pesquisa e desenvolvimento, garantindo resultados confiáveis e reproduzíveis.
Subcategorias de "Bioquímicos e reagentes"
- Biomoléculas(99.117 produtos)
- Por Alvo Biológico(99.161 produtos)
- Por uso/Efeitos Farmacológicos(6.787 produtos)
- Compostos relacionados à criopreservação e aos crioconservantes(21 produtos)
- Desinfetantes, aditivos para aquecimento de líquidos de banho e compostos relacionados(28 produtos)
- Hormónios(346 produtos)
- Biologia Vegetal(6.710 produtos)
- Metabólitos secundários(14.222 produtos)
Foram encontrados 130581 produtos de "Bioquímicos e reagentes"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
(1-Adamantaneacetyl1,D-Tyr(Et)2,Val4, Abu 6, Arg8·9)-vasopressin
CAS:<p>(1-Adamantaneacetyl1,D-Tyr(Et)2,Val4, Abu 6, Arg8·9)-vasopressin is a vasopressor analog that has been shown to be an effective treatment for congestive heart failure by acting as an agonist at the V1 receptor. It has been shown to stimulate cyclase activity and increase levels of adenosine 3',5'-cyclic monophosphate (cAMP). This drug also stimulates the production of immunoglobulin A antibodies in mice and increases the expression of leucine aminopeptidase and immunofluorescence in rat kidney cells. Vasopressin analogs are used primarily for their vasoconstrictive properties.</p>Fórmula:C62H94N16O11Pureza:Min. 95%Cor e Forma:White Off-White PowderPeso molecular:1,239.51 g/molAc-Ala-Ala-Val-Ala-Leu-Leu-Pro-Ala-Val-Leu-Leu-Ala-Leu-Leu-Ala-Pro-Ile-Glu-Thr-Asp-aldehyde trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Ala-Ala-Val-Ala-Leu-Leu-Pro-Ala-Val-Leu-Leu-Ala-Leu-Leu-Ala-Pro-Ile-Glu-Thr-Asp-aldehyde trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C95H162N20O26Pureza:Min. 95%Peso molecular:2,000.42 g/molAmyloid Dan Protein (1-34) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Dan Protein (1-34) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C185H268N48O51S2Pureza:Min. 95%Peso molecular:4,044.53 g/mol1-(Fmoc-aminomethyl)-b-D-galacturonic acid
CAS:<p>Please enquire for more information about 1-(Fmoc-aminomethyl)-b-D-galacturonic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C22H23NO8Pureza:Min. 95%Peso molecular:429.42 g/molH-Gly-Asp-Asp-Asp-Asp-Lys-bNA trifluoroacetic acid
CAS:<p>H-Gly-Asp-Asp-Asp-Asp-Lys-bNA trifluoroacetic acid is a peptide that is used as a biocatalyst in the production of microspheres. It is also known as enterokinase, and cleaves proteins at their N termini. This enzyme has been immobilized on silica gel and then applied to the production of microspheres. The half life of this enzyme is 1 hour at 37°C, but it can be increased to 8 hours by immobilizing it on silica gel using glutaraldehyde. HGAASDAAKLysBNAtrifluoroacetic acid has been shown to have a high specific activity with an efficiency of 60% and a pH range between 4 and 10. It has been shown to have high protein cleavage rates at 30°C, 37°C, and 40°C, with bovine serum albumin being the</p>Fórmula:C38H45N8O16F3Pureza:Min. 95%Peso molecular:788.76 g/molH-Gly-Glu-Gly-OH trifluoroacetic acid
CAS:<p>H-Gly-Glu-Gly-OH trifluoroacetic acid is a dilute buffer solution of amino acids. It has been used to study the thermodynamic stability of polypeptides and their sensitivity to acidic conditions. Experiments have shown that H-Gly-Glu-Gly-OH trifluoroacetic acid is more stable than glycine, glutamic acid, histidine, aspartic acid, or aspartyl. This compound is an amino acid with a high concentration of glutamic acid.</p>Fórmula:C9H15N3O6•(CF3CO2H)xPureza:Min. 95%Peso molecular:261.23 g/molFmoc-Phe-Pro-OH
CAS:<p>Fmoc-Phe-Pro-OH is a sensor molecule that has been used in supramolecular, nanostructured, and biological applications. It is a supramolecular self-assembly process that can be applied to sensors, devices, and modules. Fmoc-Phe-Pro-OH can be used as a biological source for sensing bacteria or other molecules of interest. The structural properties of Fmoc-Phe-Pro-OH have been studied extensively and it has been found to have favorable properties for use in humans. Advances in this field are ongoing with the hope of improving the understanding of biological systems and human health.</p>Fórmula:C29H28N2O5Pureza:Min. 95%Peso molecular:484.54 g/molZ-His-Phe-OH
CAS:<p>Please enquire for more information about Z-His-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C23H24N4O5Pureza:Min. 95%Peso molecular:436.46 g/molH-Gly-2-chlorotrityl resin (200-400 mesh)
CAS:<p>Please enquire for more information about H-Gly-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%For-Nle-Leu-Phe-Nle-Tyr-Lys-OH
CAS:<p>For-Nle-Leu-Phe-Nle-Tyr-Lys-OH is an amino acid sequence that is a proteolytic fragment of the erythrocyte membrane protein band 3. It has been shown to be able to inhibit the activity of cytosolic calcium and actin filament polymerization, as well as inhibiting apoptosis in human polymorphonuclear leukocytes (PMNL). This compound has been found to be effective in preventing uptake of bacteria by neutrophils, which may be due to its ability to alter the pH gradient across the membrane and increase intracellular calcium levels. For-Nle-Leu-Phe-Nle-Tyr-Lys-OH also inhibits diacylglycerol synthesis, which may contribute to its antiinflammatory effects.</p>Fórmula:C43H65N7O9Pureza:Min. 95%Peso molecular:824.02 g/mol(Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C194H300N54O58SPureza:Min. 95%Peso molecular:4,348.85 g/molc11 Bodipy 581/591
CAS:<p>C11 Bodipy 581/591 is an inhibitor used in cancer research to study the effects of protein kinase inhibitors on tumor cells. This fluorescent analog is used to track the activity of cyclin-dependent kinases, which are involved in cell cycle regulation and apoptosis. C11 Bodipy 581/591 has been shown to be effective at inhibiting the growth of human cancer cells and inducing apoptosis. It is also used as an anticancer agent in Chinese medicine. This inhibitor can be detected in urine samples, making it a valuable tool for non-invasive cancer diagnosis and monitoring. Overall, C11 Bodipy 581/591 is a promising compound for cancer research due to its potent inhibitory effects on cancer cell growth and proliferation.</p>Fórmula:C30H35BF2N2O2Pureza:Min. 95%Peso molecular:504.4 g/molo-(3-Hexyl) dabigatran ethyl ester
CAS:<p>O-(3-Hexyl) dabigatran ethyl ester is an analog of dabigatran, a potent inhibitor of human thrombin. It has been shown to have anticancer properties by inducing apoptosis and inhibiting the cell cycle in Chinese hamster ovary cells. This compound has also demonstrated promising results in inhibiting tumor growth in mice with cancer. O-(3-Hexyl) dabigatran ethyl ester is a protein kinase inhibitor that may be useful as a medicinal agent for the treatment of cancer. Its bioavailability can be measured by analyzing urine samples to determine its pharmacokinetic profile. Overall, this compound shows great potential as an effective anticancer agent with further research needed for clinical applications.</p>Fórmula:C34H41N7O5Pureza:Min. 95%Peso molecular:627.7 g/molAmyloid P Component (27-38) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid P Component (27-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C68H107N19O17SPureza:Min. 95%Peso molecular:1,494.76 g/molAmyloid β/A4 Protein Precursor770 (394-410) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (394-410) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C86H151N31O26S2Pureza:Min. 95%Peso molecular:2,099.44 g/molAmyloid β-Protein (20-29) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (20-29) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C43H66N12O17Pureza:Min. 95%Peso molecular:1,023.05 g/molH-D-Ile-Phe-Lys-pNA trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Ile-Phe-Lys-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C27H38N6O5Pureza:Min. 95%Peso molecular:526.63 g/molEndothelin-1 (human, bovine, dog, mouse, porcine, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Endothelin-1 (human, bovine, dog, mouse, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C109H159N25O32S5·C2HF3O2Pureza:Min. 95%Peso molecular:2,605.93 g/molIL-1β (163-171) (human) trifluoroacetate salt
CAS:<p>Interleukin-1 beta (IL-1β) is a cytokine that is produced by activated macrophages and T cells. It is an important regulator of immune function, inducing fever, activating the inflammatory response, and increasing vascular permeability. IL-1β is a 163-amino acid polypeptide with a molecular weight of 18.7 kDa. The trifluoroacetate salt of IL-1β has been shown to be active in vitro against human leukemic cells and to have an interferon-gamma activity in vitro.</p>Fórmula:C39H64N12O19Pureza:Min. 95%Peso molecular:1,004.99 g/molAmyloid β-Protein (10-35) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (10-35) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C133H204N34O37SPureza:Min. 95%Peso molecular:2,903.32 g/molAmyloid β-Protein (1-40) trifluoroacetate salt
CAS:<p>Amyloid beta-protein (Aβ) is a protein that is involved in the metabolic processes that are thought to be associated with Alzheimer's disease. Aβ is a peptide of 39-43 residues and is found in amyloid plaques, which are aggregates of Aβ. The amino acid sequence of human Aβ has been determined by sequencing the cDNA and gene for this protein. The structure of the protein has been studied using molecular modeling, kinetic data, and predictive biomarker studies. Cleavage products have been identified from the protein, including beta-amyloid peptide (1-40), which can be used as a diagnostic marker for Alzheimer's disease. Structural analysis has also shown lysine residues that may serve as pharmaceutical targets for therapeutic intervention.</p>Fórmula:C194H295N53O58SPureza:Min. 95%Peso molecular:4,329.81 g/molPropionyl-Amyloid b-Protein (31-34) amide
CAS:<p>Please enquire for more information about Propionyl-Amyloid b-Protein (31-34) amide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C23H43N5O5Pureza:Min. 95%Peso molecular:469.62 g/mol19-Epi fk-506
CAS:<p>19-Epi FK-506 is an analog of the immunosuppressive drug FK-506 that has shown promise as an anticancer agent. It has been found to induce apoptosis in cancer cells, particularly in Chinese hamster ovary cells and leukemia cell lines. This compound is a potent inhibitor of protein kinases, which are involved in regulating cell growth and division. 19-Epi FK-506 has been identified as a potential medicinal agent for the treatment of various types of cancer due to its ability to inhibit tumor growth and proliferation. It is excreted in urine and may have therapeutic potential as a cancer inhibitor or in combination with other inhibitors.</p>Fórmula:C44H69NO12Pureza:Min. 95%Peso molecular:804 g/mol(Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C195H300N56O56SPureza:Min. 95%Peso molecular:4,356.88 g/molGanetespib
CAS:<p>Heat shock protein 90 (HSP90) inhibitor</p>Fórmula:C20H20N4O3Pureza:Min. 95%Cor e Forma:White PowderPeso molecular:364.4 g/mol(Asn7)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>(Asn7)-Amyloid b-Protein (1-40) trifluoroacetate salt H-Asp-Ala-Glu-Phe-Arg-His-Asn-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys<br>The product is a compound that has been shown to inhibit the formation of beta amyloid peptides in the brain. It binds to the beta amyloid peptide and prevents its aggregation, thereby preventing the formation of plaques and inhibiting neuronal cell death. The product contains no detectable levels of trehalose, which makes it ideal for use in brain imaging studies. This product may also be used as a predictive biomarker for Alzheimer's disease because it can be detected in cerebrospinal fluid and plasma.</p>Fórmula:C194H296N54O57SPureza:Min. 95%Peso molecular:4,328.82 g/molBMY 7378 Dihydrochloride
CAS:<p>BMY 7378 Dihydrochloride is a selective 5-HT1A receptor antagonist, which is synthetically derived for specialized research purposes. This compound is known for its ability to bind exclusively to the 5-HT1A receptor, inhibiting the action of serotonin. Its mechanism of action involves a high-affinity blockade of serotonin at this receptor site, making it a valuable tool for understanding serotonergic signaling pathways.</p>Fórmula:C22H33Cl2N3O3Pureza:Min. 95%Peso molecular:458.42 g/mol(Nle 35)-Amyloid b-Protein (1-42) ammonium salt
CAS:<p>Please enquire for more information about (Nle 35)-Amyloid b-Protein (1-42) ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C204H313N55O60Pureza:Min. 95%Peso molecular:4,496 g/moln-Decyltetraoxyethylene
CAS:<p>N-Decyltetraoxyethylene is a fatty acid that can be synthesized by reacting naphthalene with ethylene oxide. It is used as a surfactant in pharmaceutical preparations and has been shown to have affinity for ligands such as anionic and cationic surfactants, fatty acids, and model proteins. N-Decyltetraoxyethylene also has antiviral properties, binding to influenza virus particles. This compound has been shown to exhibit bronchiolitis obliterans when administered to animals in vivo. The particle size of this compound is too small for it to be used as a respiratory inhalant drug, but the high surface area of the molecule allows it to be used as a nasal or eye drug.</p>Fórmula:C18H38O5Pureza:Min. 95%Cor e Forma:Clear LiquidPeso molecular:334.49 g/molPigment Yellow 138;3,4,5,6-Tetrachloro-N-[2-(4,5,6,7-tetrachloro-2,3-dihydro-1,3-dioxo-1H-inden-2-yl)-8-Quinolyl]phthalimide
CAS:<p>Pigment Yellow 138 is a polycarboxylic acid with the chemical formula C8H6Cl4O2. Pigment Yellow 138 has a molecular weight of 434.07 and can be used as a yellow pigment in paint, plastics, and textiles. Pigment Yellow 138 has an acidic pH and can be prepared by reacting phthalic anhydride with sodium hydroxide in aqueous solution to produce the sodium salt of pigment yellow 138. Pigment Yellow 138 is also soluble in hydroxide solutions, which makes it an excellent cross-linking agent for polymers. The color of pigments depends on the size of their particles; pigments with larger particle sizes are more opaque than those with smaller particle sizes.</p>Fórmula:C26H6Cl8N2O4Pureza:Strengh Min 95%.Peso molecular:693.96 g/molZ-Gly-Gly-Phe-OH
CAS:<p>Z-Gly-Gly-Phe-OH is a sweetener that is used in the food and beverage industry. It is also used in the manufacture of peptides for therapeutic purposes. Z-Gly-Gly-Phe-OH has been shown to be effective as an inhibitor of carboxyl esterases, which are enzymes that break down fatty acids. This inhibition leads to a delayed absorption of fats and oils. Z-Gly-Gly-Phe-OH can be synthesized by chemical methods or enzymatic methods. The former method involves the reaction between 3,4,5,6 tetrahydropyran with glyoxylic acid and glycine. The latter method involves esterification of glycine with 3,4,5,6 tetrahydropyran followed by hydrolysis of the resulting dicyclohexylurea to yield Z-glycidol and Phe.</p>Fórmula:C21H23N3O6Pureza:Min. 95%Cor e Forma:PowderPeso molecular:413.42 g/molPIPES
CAS:<p>PIPES, also known as, Piperazine-N,N-bis(2-ethanesulfonic acid) is a piperazinic buffer with an optimal pH range of 6.1-7.5 and a pKa of 6.76. This buffering agent can be used in culture media, crystallization, electrophoresis, and chromatography and is non-coordinating.</p>Fórmula:C8H18N2O6S2Cor e Forma:White Off-White PowderPeso molecular:302.37 g/mol(Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C191H291N53O56SPureza:Min. 95%Peso molecular:4,257.74 g/mol(2-Methylindol-1-yl)acetic acid·DCHA
CAS:Produto Controlado<p>Please enquire for more information about (2-Methylindol-1-yl)acetic acid·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C11H11NO2·C12H23NPureza:Min. 95%Peso molecular:370.53 g/molSB-423562
CAS:<p>SB-423562 is a synthetic compound, which is developed as a small molecule inhibitor, produced through chemical synthesis in a laboratory setting. Its mode of action involves selectively interfering with a specific biological pathway by binding to its target protein, thereby inhibiting its activity. This targeted action allows for precise modulation of signaling pathways, which can be pivotal in therapeutic interventions.</p>Fórmula:C26H32N2O4Pureza:Min. 95%Cor e Forma:PowderPeso molecular:436.54 g/molBudralazine
CAS:<p>Budralazine is a synthetic vasodilator, which is derived from a series of hydrazine analogs, known for their ability to modulate vascular tone. Its mode of action involves the direct relaxation of vascular smooth muscle. This relaxation leads to a decrease in peripheral vascular resistance and, consequently, a reduction in blood pressure. Intriguingly, Budralazine is thought to selectively target arterioles over veins, making it of particular interest in the study of vascular dynamics and hypertension.</p>Fórmula:C14H16N4Pureza:Min. 95%Peso molecular:240.3 g/molItacitinib
CAS:<p>Itacitinib is a Jak1 inhibitor that is used to treat bowel disease. Itacitinib has been shown to inhibit the growth of probiotic bacteria such as Lactobacillus and Bifidobacterium, which are beneficial for intestinal health. Itacitinib also inhibits the production of inflammatory cytokines, such as TNF-α, IL-6, and IL-8, in vitro in human monocytes. This drug has been shown to reduce the severity of bronchiolitis obliterans (a rare lung disease) in vivo in mice. Itacitinib binds to the cell factor on activated T cells and inhibits its signaling pathway. In addition, it blocks PD-L1 expression on tumor cells, thereby preventing tumor cell proliferation and inducing an M2 phenotype (a type of immune response). Finally, itacitinib inhibits Jak2 V617F activity by binding to this enzyme and causes a decrease in disease activity.</p>Fórmula:C26H23F4N9OPureza:Min. 95%Peso molecular:553.51 g/molCreatine phosphate monosodium salt hexahydrate
CAS:<p>Phosphate reservoir in muscles, aiding conversion of ADP to ATP</p>Fórmula:C4H10N3O5P·Na·6H2OCor e Forma:PowderPeso molecular:342.19 g/molAZD5069
CAS:<p>AZD5069 is a small molecule that serves as a potent and selective antagonist of the CXC chemokine receptor 2 (CXCR2). It is derived from synthetic pharmaceutical research efforts aimed at targeting key signaling pathways in inflammatory diseases. This compound functions by inhibiting the CXCR2 receptor, which plays a critical role in the recruitment and activation of neutrophils, a type of white blood cell involved in inflammation and immune responses.</p>Fórmula:C18H22F2N4O5S2Pureza:Min. 95%Peso molecular:476.52 g/molICG 001
CAS:<p>Inhibits interaction between CREB binding protein (CBP) and Wnt/β-catenin</p>Fórmula:C33H32N4O4Pureza:Min. 95%Peso molecular:548.63 g/molBAY-069
CAS:<p>BAY-069 is a small-molecule inhibitor, derived through advanced chemical synthesis, designed to selectively target critical molecular pathways in cancer cells. The compound is synthesized using a series of intricate organic reactions that ensure its specificity and potency. Its mode of action involves binding to and inhibiting the activity of key enzymes involved in the regulation of the cell cycle, thereby disrupting the proliferative capacity of malignant cells.</p>Fórmula:C22H14ClF3N2O3Pureza:Min. 95%Peso molecular:446.81 g/molTegoprazan
CAS:<p>Tegoprazan is an anti-gastric acid drug that is a proton pump inhibitor. It inhibits the production of gastric acid by inhibiting the H+, K+-ATPase enzyme (proton pump) in the gastric mucosa cells. Tegoprazan has dose-dependent effects and can be used for long-term treatment of diseases such as peptic ulcer, gastroesophageal reflux disease, and Zollinger-Ellison syndrome. Tegoprazan does not show any serious side effects, but it may cause some adverse reactions, such as drug reactions or increased risk for developing stomach cancer. Tegoprazan also has antiplatelet properties and can be used to prevent blood clot formation in patients after coronary artery bypass grafting surgery.</p>Fórmula:C20H19F2N3O3Pureza:Min. 95%Peso molecular:387.4 g/molFa-Gly-Leu-Ala-OH
CAS:<p>Fa-Gly-Leu-Ala-OH is a peptide sequence that is a potent activator of the glycine receptor. When administered, it causes the opening of ligand-gated ion channels, leading to an influx of ions and the depolarization of neurons. This peptide has been used as a research tool in studies on glycine receptors and cell biology. It can also be used as an inhibitor in studies on ion channels.</p>Fórmula:C18H25N3O6Pureza:Min. 95%Peso molecular:379.4 g/molH-D-Arg(Me)-OH acetate salt
CAS:Produto Controlado<p>H-D-Arg(Me)-OH is a peptide that has been shown to inhibit the proliferation of cancer cells in culture. It inhibits the growth of tumor cells by blocking the activity of the oxytocin receptor, which regulates cell adhesion and migration. The H-D-Arg(Me)-OH acetate salt has also been shown to promote the differentiation of basophilic leukemia cells into normal myeloid cells. This peptide is used as a control for incubated cell cultures, such as liver cells, and can be used to study protein synthesis.</p>Fórmula:C7H16N4O2Pureza:Min. 95%Peso molecular:188.23 g/molUrolithin M6
CAS:<p>Urolithin M6 is a metabolite, which is a bioactive compound derived from the metabolism of ellagitannins and ellagic acid found in certain dietary polyphenols. These polyphenols are abundant in fruits such as pomegranates, berries, and nuts. The transformation into urolithins, including Urolithin M6, is facilitated by the gut microbiota, which metabolizes these ellagitannins in the gastrointestinal tract.</p>Fórmula:C13H8O6Pureza:Min. 95%Peso molecular:260.2 g/molFmoc-L-cysteic acid disodium
CAS:<p>Please enquire for more information about Fmoc-L-cysteic acid disodium including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C18H17NO7S•Na2Pureza:Min. 95%Cor e Forma:White PowderPeso molecular:437.38 g/molH-Asp-β-Ala-OH
CAS:<p>Please enquire for more information about H-Asp-beta-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C7H12N2O5Pureza:Min. 90 Area-%Cor e Forma:PowderPeso molecular:204.18 g/molMethotrexate disodium
CAS:<p>Methotrexate is a drug that suppresses the immune system by inhibiting the production of white blood cells. It is used in the treatment of a number of diseases, including some cancers and autoimmune diseases such as rheumatoid arthritis and psoriasis. Methotrexate is metabolized to its active form, methotrexate, by an enzyme called dihydrofolate reductase (DHFR). The DHFR inhibitor activity of methotrexate blocks the synthesis of folate-dependent enzymes and prevents DNA synthesis in rapidly dividing cells. Methotrexate has been used in combination with other drugs to treat cancer. Methotrexate has also been shown to have antifungal properties against opportunistic fungal infections.</p>Fórmula:C20H20N8Na2O5Pureza:Min. 95%Cor e Forma:PowderPeso molecular:498.4 g/molPigment Red 52:1
CAS:<p>6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Its efficacy has been demonstrated through transcription-quantitative polymerase chain reactions and patch-clamp techniques on human erythrocytes. In terms of metabolism, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture</p>Pureza:Min. 95%Cyclosporin G
CAS:<p>Cyclosporin G is an immunosuppressive agent, which is derived from fungal sources with a specific mode of action that involves inhibiting calcineurin. The source of Cyclosporin G is primarily from the fermentation of the fungus *Tolypocladium inflatum*. Its mode of action involves binding to the cytosolic protein cyclophilin in T-lymphocytes, which subsequently inhibits the phosphatase activity of calcineurin. This inhibition prevents the dephosphorylation and nuclear translocation of the nuclear factor of activated T-cells (NFAT), thereby reducing the transcription of interleukin-2 and other cytokines critical for T-cell activation.</p>Fórmula:C63H113N11O12Pureza:Min. 95%Peso molecular:1,216.64 g/molPAF (C16)
CAS:<p>PAF, short for Platelet-activating factor, is a mediator of platelet aggregation and a ligand for PAF receptors. It has roles in many other leukocyte functions around inflammation and immune response, as well as, chemotaxis and vasuclar changes. The PAF signaling system can trigger significant inflammatory and thrombotic cascades, and has been show to have roles in septic shock.</p>Fórmula:C26H54NO7PPureza:Min. 95%Peso molecular:523.68 g/molUprifosbuvir
CAS:<p>Uprifosbuvir is an investigational antiviral compound, which is a nucleotide analog prodrug of uridine. It functions by targeting the hepatitis C virus (HCV) NS5B RNA-dependent RNA polymerase, an essential enzyme for viral RNA replication. As an uridine nucleotide analog, Uprifosbuvir interferes with the viral replication process by incorporating itself into the viral RNA, leading to chain termination.</p>Fórmula:C22H29ClN3O9PPureza:Min. 95%Peso molecular:545.9 g/molPT2977
CAS:<p>PT2977 is a small-molecule inhibitor, which is derived from rational drug design, with a specific mode of action targeting hypoxia-inducible factor (HIF) pathways. This compound acts by selectively inhibiting HIF-2α, a critical driver of cellular response to hypoxic conditions, thus interfering with the transcription of genes involved in angiogenesis, erythropoiesis, and metabolic adaptation.</p>Fórmula:C17H12F3NO4SPureza:Min. 95%Peso molecular:383.34 g/molTrinexapac
CAS:<p>Trinexapac is a fungicide that belongs to the group of systemic, acylated triazoles. It is used for protecting perennial ryegrass against diseases caused by fungi. Trinexapac has been shown to inhibit fatty acid synthesis and cause an accumulation of monocarboxylic acids in plant tissue. This effect is due to its ability to inhibit the enzyme acylation reaction, which converts acetyl-CoA into fatty acids. Trinexapac also inhibits the production of ethylene and other essential oils in plants, as well as inhibiting sporulation in mollusks. Trinexapac is applied as a liquid or granular formulation and can be detected using analytical methods such as liquid chromatography or gas chromatography.</p>Fórmula:C11H12O5Pureza:Min. 95%Cor e Forma:PowderPeso molecular:224.21 g/molDesmopressin
CAS:Produto Controlado<p>Desmopressin is a synthetic analog of the natural hormone arginine vasopressin. It has been shown to be effective in the treatment of primary nocturnal enuresis, and a number of studies have reported that desmopressin is an effective therapy for idiopathic nocturnal enuresis. Desmopressin also has effects on water permeability, hemolysis, and protein synthesis. It increases the concentration of camp levels in urine and plasma while also inhibiting erythrocyte aggregation. Desmopressin has been shown to be more effective than placebo in women with primary nocturnal enuresis.</p>Fórmula:C46H64N14O12S2Pureza:Min. 95%Cor e Forma:PowderPeso molecular:1,069.22 g/mol(-)-Lariciresinol
CAS:<p>Lariciresinol is a natural compound that has been shown to have antioxidative properties and inhibit the growth of cancer cells in vitro. It has also been shown to reduce the metastatic potential of colorectal cancer cells by inhibiting fatty acid synthesis. Lariciresinol has synergistic effects when combined with other natural compounds, such as resveratrol, for example. This compound inhibits the proliferation of cancer cells by inducing apoptosis through a multivariate logistic regression analysis. The mechanism of lariciresinol-mediated apoptosis includes inhibition of transcriptional regulation and mitochondrial membrane potential, which leads to an increase in reactive oxygen species (ROS) and reactive nitrogen species (RNS). Lariciresinol also inhibits bacterial growth by binding to DNA gyrase and topoisomerase IV and interfering with transcription through RNA polymerase.</p>Fórmula:C20H24O6Pureza:Min. 95%Peso molecular:360.4 g/molMethyl N-[(1S)-1-[[(2S)-2-[5-[6-[2-[(2S)-1-[(2S)-2-[(methoxycarbonyl)amino]-3-methyl-1-oxobutyl]-2-pyrrolidinyl]-1H-benzimidazol-6-y l]-2-naphthalenyl]-1H-imidazol-2-yl]-1-pyrrolidinyl]carbonyl]-2-methylpropyl]carbamate dihydrochloride
CAS:<p>Methyl N-[(1S)-1-[[(2S)-2-[5-[6-[2-[(2S)-1-[(2S)-2-[(methoxycarbonyl)amino]-3-methyl-1-oxobutyl]-2-pyrrolidinyl]-1H-benzimidazol-6-y l]-2-naphthalenyl]-1H-imidazol-2-yl]-1-pyrrolidinyl]carbonyl]-2-methylpropyl]carbamate dihydrochloride is a matrix effect medicine that belongs to the group of drugs used in the treatment of HIV infection. It has been shown to be effective against PDL1, which is often expressed by tumors and is associated with poor prognosis. This drug has also been shown to have antiviral activity against hepatitis C virus (HCV). The pharmacokinetic properties of methyl N-[(</p>Fórmula:C42H52Cl2N8O6Pureza:Min. 95%Peso molecular:835.8 g/molBRD6688
CAS:<p>BRD6688 is a protein inhibitor that binds to and inhibits the activity of GABA transporters. It is a potent inhibitor of the gaba transporter (GAT) with an IC50 of 0.2 μM. BRD6688 has been shown to inhibit the acetylation of histone proteins, which are important for transcriptional regulation and gene expression. BRD6688 also has a thermodynamic inhibitory constant (Ki) of 1.4 μM and a kinetic inhibitory constant (Ki) of 0.3 μM, indicating that it binds tightly to GATs and does not dissociate easily from it. The Ki values were determined by measuring the inhibition of GAT-mediated chloride transport in cells cultured in vitro. This drug also inhibits antigen presentation in T cells by inhibiting protein synthesis and cell division, as well as histone methylation during mitosis, leading to downregulation of cell-surface antigens on B cells.</p>Fórmula:C16H18N4OPureza:Min. 95%Cor e Forma:PowderPeso molecular:282.34 g/molOctreotide trifluoroacetate salt (Dimer, Parallel) (
<p>Please enquire for more information about Octreotide trifluoroacetate salt (Dimer, Parallel) ( including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C98H132N20O20S4Pureza:Min. 95%Peso molecular:2,038.48 g/molGW 0742
CAS:<p>Peroxisome proliferator-activated receptor PPARβ/ÎŽ agonist</p>Fórmula:C21H17F4NO3S2Pureza:Min. 95%Peso molecular:471.49 g/molAngiotensin I human acetate salt hydrate
CAS:<p>Angiotensin I human acetate salt hydrate is a synthetic peptide, which is a derivative of the human angiotensinogen protein. It is sourced through chemical synthesis methods that replicate the natural sequence of this protein's active fragment. The mode of action involves conversion by the enzyme angiotensin-converting enzyme (ACE) into angiotensin II, a potent vasoconstrictor, which plays a critical role in blood pressure regulation and fluid balance.</p>Fórmula:C62H89N17O14·xC2H4O2·yH2OPureza:Min. 95%PRI-724
CAS:<p>PRI-724 is an investigational small molecule known as a selective inhibitor of the Wnt/β-catenin signaling pathway. It is derived from extensive research into targeting dysregulated cellular pathways implicated in oncogenesis. PRI-724 operates by binding to the transcriptional co-activator CBP, thereby disrupting the interaction between CBP and β-catenin, which is crucial for the transcription of genes involved in cell proliferation and survival.</p>Fórmula:C33H35N6O7PPureza:Min. 95%Peso molecular:658.6 g/molAZD 5991
CAS:<p>AZD 5991 is a cell-specific compound that inhibits the apoptosis pathway. It has been shown to have potent antitumor activity against T-cell lymphomas and other cancers in vitro and in vivo. AZD 5991 targets cyclin D2 and PCSK9, which are proteins involved in the regulation of the cell cycle, thereby inhibiting tumor growth. This drug also exhibits potent inhibition of ribosome synthesis, which may be due to its ability to inhibit protein synthesis by targeting the enzyme activities required for ribosome production. AZD 5991 also exhibits anti-inflammatory properties that may be due to its ability to inhibit colony-stimulating factor (CSF) production.</p>Pureza:Min. 95%Tizoxanide
CAS:<p>Anti-parasitic; pyruvate ferredoxin oxidoreductase inhibitor</p>Fórmula:C10H7N3O4SPureza:Min. 95%Cor e Forma:PowderPeso molecular:265.25 g/molCJC-1295 trifluoroacetate
CAS:<p>A synthetic peptide that stimulates growth hormone release through GHRH receptors. TFA salt</p>Fórmula:C165H269N47O46Pureza:Min. 95%Cor e Forma:PowderPeso molecular:3,647.19 g/molClopidogrel
CAS:Produto Controlado<p>Methyl (2S)-2-(2-chlorophenyl)-2-(9-thia-4-azabicyclo[4.3.0]nona-7,10-dien-4-yl)acetate, also know as Clopidogrel, is a potent inhibitor of the platelet aggregation. It reduces blood clotting by inhibiting the ADP receptor on the surface of platelets, thereby inhibiting the aggregation and adhesion of platelets. Clopidogrel has been shown to be effective in preventing thrombosis, myocardial infarction (heart attack), and stroke. Clopidogrel inhibits the activity of cytochrome P450 3A4 (CYP3A4) and p2Y 12 receptors. Clopidogrel has been shown to have synergic effects with nonsteroidal anti-inflammatory drugs (NSAIDs). The polymorphic nature of Clopidogrel can be monitored using a liquid chromatography-tandem mass spectrometry (LC-MS/MS) method for quantification in biological samples such as human serum and plasma.</p>Fórmula:C16H16ClNO2SPureza:Min. 95%Cor e Forma:PowderPeso molecular:321.82 g/molSMN-C3
CAS:<p>SMN-C3 is a synthetic compound designed specifically as a targeted therapeutic agent. It is derived through advanced chemical synthesis techniques, utilizing a meticulous approach to optimize efficacy and specificity. The mode of action of SMN-C3 involves precise interaction with select molecular targets, thereby modulating biological pathways with high specificity. This interaction is designed to alter the course of disease processes, offering potential therapeutic benefits.</p>Fórmula:C24H28N6OPureza:Min. 95%Peso molecular:416.5 g/molFolitixorin calcium
CAS:<p>Folitixorin calcium is an inhibitor of peptide interactions. It binds to receptor proteins, preventing the binding of endogenous ligands. Folitixorin calcium can be used as a research tool to study protein interactions, and also as an activator or ligand in the study of receptor proteins. This compound has high purity and is suitable for use in life science research. It is a potent inhibitor of ion channels and antibodies, with no activity against other types of receptors.</p>Fórmula:C20H23N7O6•CaPureza:Min. 95%Peso molecular:497.52 g/molBerubicin
CAS:<p>Berubicin is an anthracycline-based chemotherapeutic agent, which is a semi-synthetic derivative sourced primarily from the bacterium Streptomyces peucetius. It operates by intercalating into DNA strands, disrupting the replication and transcription processes, which ultimately induces apoptosis in rapidly dividing tumor cells.</p>Fórmula:C34H35NO11Pureza:Min. 95%Cor e Forma:PowderPeso molecular:633.6 g/molα-Helical CRF (9-41)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C166H274N46O53S2Peso molecular:3,826.44 g/molPLM derived peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C49H96N24O12Peso molecular:1,213.47 g/molFas C-Terminal Tripeptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C16H29N3O6Peso molecular:359.43 g/molFITC-LC-Myelin Basic Protein Peptide Substrate
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C66H92N20O17SPeso molecular:1,325.4 g/molAntioxidant peptide A
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C31H54N12O7S2Peso molecular:770.97 g/molTGF α(34-43) (rat)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C44H67N15O13S2Peso molecular:1,078.25 g/molR-G-D-S-P-A-S-S-K-P
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C40H68N14O16Peso molecular:1,001.07 g/molAmyloid Bri Protein (1-34)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C173H273N49O52S2Peso molecular:3,935.55 g/molSelectin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C62H105N16O18S2Peso molecular:1,426.75 g/molCecropin A (1-7)-Melittin A (2-9) amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C89H152N22O15Peso molecular:1,770.34 g/molBiotin-Angiotensin I, human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C72H103N19O16SPeso molecular:1,522.81 g/molPlatelet-Derived Growth Factor Receptor Substrate 1
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C52H81N12O19PPeso molecular:1,209.29 g/molAngiotensinogen (1-14), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C83H122N24O19Peso molecular:1,760.05 g/mol[Ala144]-PLP (139-151) A144-PLP(139-151)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C64H99N19O17Peso molecular:1,406.62 g/molAcyl Carrier Protein (65-74) (amide)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C47H75N13O15Peso molecular:1,062.20 g/molMARCKS Substrate (151-175)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C147H246N41O40P3Peso molecular:3,320.78 g/molAdipokinetic Hormone II Locusta Migratoria
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C43H57N11O11Peso molecular:904.02 g/molGastric Inhibitory Polypeptide (1-30) (porcine)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C162H244N40O48SPeso molecular:3,551.97 g/molEndokinin A/B
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C50H77N13O12SPeso molecular:1,084.32 g/mol[D-Ala2]-β-Casomorphin (1-5), bovine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C28H35N5O7Peso molecular:553.6 g/molIGF-II (33-40)
CAS:<p>This is a synthetic IGF-II peptide fragment (33-40) that has been immunized with an antiserum against the human growth hormone. It is used to measure the level of IGF-II in blood or serum. The immunizing antiserum cross-reacts with IgF-I and can also be used as a control for deficiency.</p>Fórmula:C38H74N20O12Pureza:Min. 95%Peso molecular:1,003.12 g/molP69 (522-534), M. leprae
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C52H84N14O21Peso molecular:1,241.33 g/molcAMP Dependent PK Inhibitor (5-22), amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C84H137N29O26Peso molecular:1,969.16 g/molIntermedin-53 (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C247H397N83O73S3Peso molecular:5,793.61 g/molp3K, (Lys 58 Lys 60 Lys 63) Ea(52-68)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C77H129N23O25Peso molecular:1,777.03 g/molMinigastrin I (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C74H99N15O26SPeso molecular:1,645.66 g/mol[D-Ala2]-beta-Casomorphin (1-5) amide (bovine)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C28H36N6O6Peso molecular:552.64 g/mol[Pyr4]-MBP (4-14)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C60H100N20O17Peso molecular:1,391.61 g/mol[D-Leu2]-Melanocyte-Stimulating Hormone-Release Inhibiting Factor
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C13H24N4O3Peso molecular:284.36 g/mol[Asn670,Leu671]-Amyloid β/A4 Protein Precursor770 (667-675)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C44H66N10O18Peso molecular:1,023.07 g/molBAD (103-127), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C137H212N42O39SPeso molecular:3,103.54 g/mol[D-Ser14]-Humanin (HN)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C119H204N34O32S2Peso molecular:2,687.28 g/molLeucokinin IV
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C41H52N12O12Peso molecular:904.9 g/mol[D-Phe11]-Neurotensin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C78H121N21O19Peso molecular:1,657 g/molβ-Amyloid (1-33)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C164H242N46O51Peso molecular:3,673.94 g/mol[Tyr11]-Somatostatin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C76H102N18O20S2Peso molecular:1,651.91 g/molHelodormin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C176H285N47O49Peso molecular:3,843.47 g/molBone Matrix Proteins
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C40H67N13O14Peso molecular:954.06 g/molCathepsin S substrate
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C41H66N12O9Peso molecular:871.08 g/molPACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C61H110N24O14Peso molecular:1,403.71 g/molPreprogalanin 28-67, rat
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C198H312N62O58Peso molecular:4,488.96 g/mol[Tyr1]-Adipokinetic Hormone, locust
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C58H78N14O15Peso molecular:1,211.5 g/molBiotin-Obestatin (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C126H190N34O35Peso molecular:2,773.19 g/molDynorphin A (2-17), porcine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C90H146N30O21Peso molecular:1,984.36 g/molβ-Amyloid Protein Precursor (657-676)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C95H152N30O31Peso molecular:2,210.45 g/molAc-Adhesin (1025-1044) amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C97H160N26O32Peso molecular:2,202.51 g/molAldosterone Secretion Inhibiting Factor (1-35) (bovine)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C164H278N58O45S4Peso molecular:3,910.64 g/mol[Trp11]-Neurotensin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C80H122N22O19Peso molecular:1,696 g/molCalcium/Calmodulin Dependent Protein Kinase II-g (345-358)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C58H107N21O22Peso molecular:1,450.63 g/molEndothelin-1 (1-15), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C70H108N16O24S5Peso molecular:1,718.02 g/molBiotin-Insulin Receptor (1142-1153)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C82H121N21O26Peso molecular:1,849.07 g/molExendin 4 (3-39)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C176H271N46O58S1Peso molecular:3,991.36 g/molDok-4 (130-145)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C83H128N22O25SPeso molecular:1,866.1 g/molCasein Kinase II Receptor Peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C52H87N19O24Peso molecular:1,362.3 g/molGnT-V (nt38-67)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C54H89N13O13SPeso molecular:1,159.45 g/molPKCe pseudosubstrate derived peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C83H155N39O21SPeso molecular:2,067.47 g/molα-CGRP (19-37), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C86H137N25O25Peso molecular:1,921.20 g/molPannexin-1 Fragment (4515)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C59H104N22O20Peso molecular:1,441.62 g/molPAR-1-selective peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C35H58N10O9Peso molecular:762.91 g/molLeucokinin III
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C40H52N12O13Peso molecular:908.9 g/molβ-Bag Cell Peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C33H53N13O6Peso molecular:727.87 g/molAc-d-Endorphin (bovine, camel, mouse, ovine)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C138H217N35O40SPeso molecular:3,038.54 g/molα-Substance IB
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C33H51N9O7Peso molecular:685.82 g/molIntermedin (rat)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C226H361N75O64S2Peso molecular:5,216.99 g/molHepatitis B Virus Receptor Binding Fragment
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C140H185N35O42Peso molecular:3,030.17 g/molNon-Ab Component of Alzheimer's Disease Amyloid
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C141H235N39O49Peso molecular:3,260.68 g/mol[Pro34]-Neuropeptide Y, human, rat
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C189H285N55O57SPeso molecular:4,271.67 g/molBDC 2.5(A)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C60H99N19O14SPeso molecular:1,342.64 g/molAc-Neurotrophin Receptor (368-381) amide (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C69H124N22O19Peso molecular:1,565.89 g/molβ-Casomorphin (1-3) amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C23H28N4O4Peso molecular:424.50 g/molBiotin-Calcitonin (salmon I)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C155H254N46O50S3Peso molecular:3,658.22 g/mol[Tyr0]-pTH-Related Protein (1-34) (human, rat)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C189H296N58O50Peso molecular:4,180.79 g/molAngiotensin II type 1 receptor (181-187), AT1, ATE.
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C40H52N10O13Peso molecular:880.92 g/molKinase Domain of Insulin Receptor (2)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C72H108N19O27PPeso molecular:1,702.77 g/molTNF-α (46-65) (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C110H172N24O30Peso molecular:2,310.74 g/molβ-Casomorphin (1-5) (bovine)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C30H37N5O7Peso molecular:579.66 g/molIL-8 Inhibitor
CAS:<p>IL-8 Inhibitor Ac-Arg-Arg-Trp-Trp-Cys-Arg-NH2 is a molecule that blocks the receptor for IL-8, a c-c chemokine. This leads to reduced inflammation and decreased activation of cells in the inflammatory process. IL-8 Inhibitor Ac-Arg-Arg-Trp-Trp-Cys--Arg--NH2 has been shown to be effective in reducing chronic bronchitis and pancreatitis in animal models. The effective dose for IL 8 inhibitor is not yet known.</p>Fórmula:C45H66N18O7SPureza:Min. 95%Peso molecular:1,003.19 g/mol[Nle253]-HSV-1 UL 26 Open Reading Frame (238-257)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C102H152N26O29Peso molecular:2,206.51 g/mol[Ala3,11,18, Nle7] Endothelin-1, human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C109H161N25O29S2Peso molecular:2,349.78 g/molPrepro VIP (111-122) (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C53H87N13O21Peso molecular:1,242.36 g/molα-Casomorphin (1-2)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C14H18N2O4Peso molecular:278.31 g/molHPV-E6-C
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C110H178N36O30SPeso molecular:2,516.92 g/molErythromycin resistance peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C31H52N8O6SPeso molecular:664.86 g/molTNF-α(71-82), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C51H91N19O18Peso molecular:1,258.41 g/molMAP Kinase Substrate
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C101H172N30O32Peso molecular:2,318.66 g/mol(D-His(Bzl)6)-LHRH (1-7) (free acid)
CAS:<p>Please enquire for more information about (D-His(Bzl)6)-LHRH (1-7) (free acid) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C53H62N12O11Pureza:Min. 95%Peso molecular:1,043.13 g/molβ-Amyloid (2-40)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C190H290N52O55SPeso molecular:4,214.81 g/mol[Met5,Arg6,7,Val8,Gly9] Enkephalin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C46H71N15O11SPeso molecular:1,042.24 g/mol[Lys0] g-1-MSH, amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C78H109N23O15SPeso molecular:1,640.95 g/molKemptide Negative Control
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C32H61N13O8Peso molecular:755.93 g/molδ1-MSH, amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C72H97N21O14SPeso molecular:1,512.8 g/molPKA Regulatory Subunit II Substrate
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C92H151N28O32PPeso molecular:2,192.39 g/molFmoc-Mating Factor a
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C97H125N20O19SPeso molecular:1,907.26 g/mol[Des-Leu26,Cys(Acm)20,31]-EGF (20-31)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C57H87N15O22S3Peso molecular:1,430.61 g/molC-terminal Proghrelin Isoform Peptide, mouse
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C50H86N22O17Peso molecular:1,267.38 g/molEcdysis-Triggering Hormone (Manduca sexta)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C127H206N36O38S3Peso molecular:2,941.45 g/mol[Ile-Ser]-Bradykinin (T-Kinin)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C59H89N17O14Peso molecular:1,260.47 g/molNeuropeptide EI-Gly-Arg-Arg-MCH (human, mouse, rat)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C182H282N54O52S4Peso molecular:4,186.86 g/molα-CGRP (33-37) (canine, mouse, porcine, rat)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C22H32N6O8Peso molecular:508.54 g/molForkhead derived peptide, Woodtide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C68H123N21O20SPeso molecular:1,586.93 g/mol[Arg8]-Vasotocin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C43H67N15O12S2Peso molecular:1,050.23 g/mol[D-Tyr11]-Neurotensin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C78H121N21O20Peso molecular:1,673 g/mol[Pyr6]-Substance P (6-11)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C36H49N7O7SPeso molecular:723.91 g/molbFGF Inhibitory Peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C36H53N11O11Peso molecular:815.89 g/molInsulin-Like Growth Factor II (69-84)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C83H124N20O26Peso molecular:1,817.9 g/mol[Ala286]-Calmodulin-Dependent Protein Kinase II (281-302) ((Ala286)-CaMK-II (281-302))
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C111H191N39O29S2Peso molecular:2,600.07 g/molAmyloid β-Protein (33-42)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C41H74N10O11SPeso molecular:915.17 g/molHistone H3 (116-136), N15-39
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C112H197N39O30Peso molecular:2,570 g/molGRF (free acid) (human)
<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Fórmula:C215H357N71O67SPeso molecular:5,040.74 g/mol[Val35] -β-Amyloid (1-42)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C203H311N55O60Peso molecular:4,481.96 g/molGRF, porcine
<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Fórmula:C219H365N73O66SPeso molecular:5,108.86 g/molDynorphin A (7-17), porcine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C65H108N22O16Peso molecular:1,453.72 g/molBiotin-RR-SRC, Insulin Receptor Tyrosine Kinase Substrate
<p>Catalogue peptide; min. 95% purity</p>Peso molecular:1,745.99 g/molBAM-12P, Bovine Adrenal Medulla Docosapeptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C62H97N21O16S1Peso molecular:1,424.66 g/molTransforming Growth Factor β1 Peptide, TGF-β1 (60-66), amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C45H78N12O10Peso molecular:947.20 g/mol[D-Trp2] Met-Enkephalin, amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C36H43N7O6SPeso molecular:701.85 g/molParathyroid Hormone (1-34)-Lys(Biotin), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C197H317N59O54S3Peso molecular:4,472.26 g/molAntioxidant peptide B
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C57H91N17O15Peso molecular:1,254.47 g/molIL-1b (208-240) (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C191H292N48O51SPeso molecular:4,108.81 g/mol[Cys0]-GTP-Binding Protein Gsa (28-42)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C85H143N30O24SPeso molecular:2,001.29 g/molFMRF amide Molluscan Cardioexcitatory Peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C29H42N8O4SPeso molecular:598.76 g/molEGF Receptor (988-993) (phosphorylated) (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C31H46N7O16PPeso molecular:804.7 g/molCecropin P1 (porcine)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C147H253N46O43Peso molecular:3,338.93 g/mol
